KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH24: KPNIH24_10865
Entry
KPNIH24_10865     CDS       T03369                                 

Definition
(GenBank) UDP-galactopyranose mutase
  KO
K01854  UDP-galactopyranose mutase [EC:5.4.99.9]
Organism
kph  Klebsiella pneumoniae subsp. pneumoniae KPNIH24
Pathway
kph00052  Galactose metabolism
kph00520  Amino sugar and nucleotide sugar metabolism
kph00541  O-Antigen nucleotide sugar biosynthesis
kph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    KPNIH24_10865
   00520 Amino sugar and nucleotide sugar metabolism
    KPNIH24_10865
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    KPNIH24_10865
Enzymes [BR:kph01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.9  UDP-galactopyranose mutase
     KPNIH24_10865
SSDB
Motif
Pfam: GLF
Other DBs
NCBI-ProteinID: AID95720
LinkDB
Structure
PDB: 

Position
2280050..2281000
AA seq 316 aa
MWNYVNKHAEMMPYVNRVKATVNGQVFSLPINLHTINQFFSKTCSPDEARALIAEKGDST
IADPQTFEEQALRFIGKELYEAFFKGYTIKQWGMQPSELPASILKRLPVRFNYDDNYFNH
KFQGMPKCGYTQMIKSILNHENIKVDLQREFIVDERTHYDHVFYSGPLDAFYGYQYGRLG
YRTLDFKKFTYQGDYQGCAVMNYCSVDVPYTRITEHKYFSPWEQHDGSVCYKEYSRACEE
NDIPYYPIRQMGEMALLEKYLSLAENETNITFVGRLGTYRYLDMDVTIAEALKTAEVYLN
SLTDNQPMPVFTVSVR
NT seq 951 nt   +upstreamnt  +downstreamnt
gtgtggaactatgtcaataagcatgcagagatgatgccctatgtgaaccgggttaaagcg
acagttaatggtcaggtattttccctacctattaatttgcatactatcaatcagtttttc
tcaaaaacttgttcgcctgatgaggccagagcgctcattgctgagaaaggggacagcact
attgctgatccacaaacttttgaagagcaagcgttacgctttattggtaaagagttatat
gaggccttttttaaaggatatacgattaaacagtgggggatgcaaccctcggaactgccc
gcatctattcttaaacgtcttcctgttcgttttaactatgatgataattattttaaccac
aaatttcagggcatgccgaaatgtggttatacgcagatgattaagtccattctcaatcat
gaaaatatcaaggttgacttacagcgggaatttatcgttgacgagcgaactcattacgat
cacgtattctatagcggtccattagatgcgttttatggctaccaatatggccgtctgggc
tatcgaacattagattttaaaaagtttacctatcagggtgattaccagggctgcgcagtg
atgaactattgttctgttgatgtcccctatactcgcatcactgaacataaatatttttct
ccctgggaacaacacgacggctctgtttgttataaagagtatagccgtgcttgtgaagaa
aatgatattccttactatcctattcgccagatgggagagatggctcttcttgaaaaatat
ttgtcactggccgagaatgaaaccaatatcacttttgtcggtcgtcttggaacctaccgt
tacctcgacatggatgtgaccatcgccgaagcattgaaaacggcagaagtctatttaaat
tcactcactgataatcagccaatgcctgtgtttacggtttctgtacgatga

DBGET integrated database retrieval system