KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH24: KPNIH24_13675Help
Entry
KPNIH24_13675     CDS       T03369                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
kph  Klebsiella pneumoniae subsp. pneumoniae KPNIH24
Pathway
kph00480  Glutathione metabolism
kph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kph00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KPNIH24_13675
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kph02000]
    KPNIH24_13675
Enzymes [BR:kph01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     KPNIH24_13675
Transporters [BR:kph02000]
 Other transporters
  Pores ion channels [TC:1]
   KPNIH24_13675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_2 GST_N_3 GST_C_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AID96252
LinkDB All DBs
Position
complement(2846587..2847192)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHIALRESGLDFTLQSVDLAQKRLENGEDYLLINPKGQVPALLLDDD
ILLTEGVAIMQYIADQVPDRHLLAPVGSIARYQTLEWLNYVATELHKSFTPLFRPDTPED
YKPVARGLLEKKLQYVDAALADKQWLTGHRFTIADGYLFTVLRWAYAIKLDMAAYGHIGS
WMTQVAARPAVAAALAAEGLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctacaaacccggcgcctgttcccttgcctcgcatattgccctgcgcgaa
agcggtctggattttaccctgcagagcgtggatctggcccagaaacggctggaaaacggg
gaagactatctgctgatcaacccgaaaggtcaggtgccggcgctgctgctggatgatgat
atcctgctcactgagggcgtagccatcatgcagtacatcgcagaccaggtgccggatcgt
catctgctggcgccggtgggctcgattgcgcgctatcagactctcgaatggctgaactat
gtggccaccgagctgcataaaagctttaccccgctgttccgcccggataccccggaggac
tataagcctgtcgcgcgggggctgcttgagaaaaagctgcaatacgttgatgcagcgctg
gcagacaaacagtggctgaccggccatcgcttcaccattgccgatggttatctgtttacg
gtgctgcgctgggcctatgctataaaactggatatggctgcctatggtcatatcggcagc
tggatgacgcaggtggcagcgcgtccggcggtggcggccgcactggcggctgaaggctta
aaataa

DBGET integrated database retrieval system