KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH24: KPNIH24_18160
Entry
KPNIH24_18160     CDS       T03369                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
kph  Klebsiella pneumoniae subsp. pneumoniae KPNIH24
Pathway
kph00040  Pentose and glucuronate interconversions
kph00051  Fructose and mannose metabolism
kph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KPNIH24_18160
   00051 Fructose and mannose metabolism
    KPNIH24_18160
Enzymes [BR:kph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     KPNIH24_18160
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C ADH_N_2 ThiF
Other DBs
NCBI-ProteinID: AID97103
LinkDB
Position
complement(3721499..3722542)
AA seq 347 aa
MKNSKAILKTPGTMKIIAADIPVPKEHEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVVAVGSRVSKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPDNMGTMEGALVEPAAVGMHAAMLADVKPGKKIVILGAGCI
GLMTLQACKCLGATDIAVVDVLEKRLAMAGKLGATTVINGAKEDTVARCQQFSGDIGADI
VFETAGSAITVKQAPYLVMRGGKIMIVGTVPGDSAINFLKINREVSIQTVFRYANRYPVT
IEAISSGRFDVKSMVTHIYDYEDVQRAFDESVNNKREIIKGVIKVNH
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaaaattcaaaagcgatattaaaaaccccgggtacgatgaaaattattgccgccgat
atcccggtacccaaagagcatgaagtgctgatcaaagttgaatacgttggtatttgcggt
tcagatgttcacgggtttgaatcgggcccttttattccgccgaaagacccaaaccaggaa
attggtctcgggcatgaatgtgccggtacggtggtggcggtgggaagtcgcgtcagtaaa
tttaaaccgggcgaccgggtgaacattgaacccggcgtgccgtgcggccactgccgctac
tgtctggaggggaaatacaacatctgccctgatgtcgactttatggccacgcagcctaac
tatcgcggcgcgctaacccactatctatgccatccggaaagcttcacttacaagctaccc
gataacatgggcaccatggaaggcgcgctggtagagcctgcggcggtagggatgcatgcc
gcaatgctggctgacgtgaagcctggcaagaaaatcgtcatcctgggggccggctgtatt
ggcttaatgaccctgcaagcctgtaagtgtttaggggcaaccgacatcgccgttgtcgat
gttctggaaaagcgtctggccatggccgggaagcttggggcgacgaccgtcatcaacggt
gcgaaagaggacaccgtcgcccgctgtcagcaattctccggcgatatcggggcagacatt
gtttttgaaacggccggctcggcgatcaccgtgaagcaggctccgtatctggtgatgcgc
ggcgggaaaatcatgatcgttggtacggttcccggagattcggcgattaattttctcaaa
attaaccgtgaagtctcaattcagaccgttttccgctatgccaaccgctatccggtcacc
attgaagccatttcctccgggcgtttcgatgtcaagtcgatggtgacgcatatttatgat
tatgaagatgttcagcgcgcgtttgacgagtccgttaacaacaaacgcgaaattatcaaa
ggcgttattaaagttaaccattaa

DBGET integrated database retrieval system