KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH24: KPNIH24_20785
Entry
KPNIH24_20785     CDS       T03369                                 

Definition
(GenBank) UDP-galactose-4-epimerase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
kph  Klebsiella pneumoniae subsp. pneumoniae KPNIH24
Pathway
kph00052  Galactose metabolism
kph00520  Amino sugar and nucleotide sugar metabolism
kph00541  O-Antigen nucleotide sugar biosynthesis
kph01100  Metabolic pathways
Module
kph_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:kph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    KPNIH24_20785
   00520 Amino sugar and nucleotide sugar metabolism
    KPNIH24_20785
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    KPNIH24_20785
Enzymes [BR:kph01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     KPNIH24_20785
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind NmrA NAD_binding_10 KR adh_short NAD_binding_4 UDPG_MGDP_dh_N adh_short_C2 TrkA_N
Other DBs
NCBI-ProteinID: AID97599
LinkDB
Position
4251477..4252493
AA seq 338 aa
MKVLVTGGSGYIGSHTCVQLLQQGHEVVILDNLCNSKRSVLPVIERLGGKEATFIEGDIR
NEALMTEILHDHAIEAVIHFAGLKAVGESVAKPLEYYDNNVTGTLKLVSAMRAAGVKNFI
FSSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPEWSIALLRYFNP
VGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRESLAIFGNDYPTEDGTGVRDYIHVMDLA
DGHVAAMEKLADKAGVHIYNLGAGVGSSVLDVVNAFSKACGKPINYHFAPRRDGDLPAYW
ADAAKADRELNWRVTRNLDEMAQDTWHWQSRHPQGYPD
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgaaagttctggttacaggtggtagcggttacattggaagtcatacctgcgttcaactg
ctgcagcagggacacgaggtggtgatcctcgacaatctctgcaacagcaagcgcagcgta
ctaccggtgattgaacgtctcggcggcaaagaagccacctttattgaaggcgatattcgt
aacgaagcgctgatgacggagatcctccacgatcacgccattgaggcagtgatccacttc
gccgggctgaaagccgtcggggagtccgtcgccaagccgctggaatattacgacaataac
gtcaccggcacactgaaattagtctctgccatgcgcgccgctggcgtgaagaactttatc
tttagctcctccgctaccgtctacggcgatcagccgaaaatcccgtatgtcgaaagcttc
ccgaccggcaccccgcaaagcccctacggcaaaagcaagctgatggtggagcagatcctg
accgacctgcagaaagcccagccggagtggagcattgccctgctgcgctacttcaacccg
gtcggcgcccacccgtcgggcgacatgggggaagacccgcaggggatcccgaacaacctg
atgccctacatcgcccaggtcgccgttggccgtcgcgaatcgctggccatttttggtaac
gactatccgaccgaagatggtaccggcgtgcgcgattacatccatgtgatggacctcgcc
gatggccacgtcgcggccatggaaaaactggctgacaaagccggggtgcatatctacaac
cttggcgccggcgtcggcagcagcgtgctcgacgtagtcaatgctttcagcaaggcctgc
ggcaaacccattaactaccatttcgcgccgcgccgcgatggcgacctcccggcctactgg
gcggatgctgccaaggccgaccgcgagctgaactggcgcgtaacgcgcaacctggacgaa
atggcgcaggacacctggcactggcagtcccgtcatccgcagggttatccagactaa

DBGET integrated database retrieval system