KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH24: KPNIH24_20790
Entry
KPNIH24_20790     CDS       T03369                                 

Definition
(GenBank) galactose-1-phosphate uridylyltransferase
  KO
K00965  UDPglucose--hexose-1-phosphate uridylyltransferase [EC:2.7.7.12]
Organism
kph  Klebsiella pneumoniae subsp. pneumoniae KPNIH24
Pathway
kph00052  Galactose metabolism
kph00520  Amino sugar and nucleotide sugar metabolism
kph01100  Metabolic pathways
Module
kph_M00554  Nucleotide sugar biosynthesis, galactose => UDP-galactose
kph_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:kph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    KPNIH24_20790
   00520 Amino sugar and nucleotide sugar metabolism
    KPNIH24_20790
Enzymes [BR:kph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.12  UDP-glucose---hexose-1-phosphate uridylyltransferase
     KPNIH24_20790
SSDB
Motif
Pfam: GalP_UDP_tr_C GalP_UDP_transf HIT DUF4921
Other DBs
NCBI-ProteinID: AID97600
LinkDB
Position
4252503..4253549
AA seq 348 aa
MSVFNPVDHPHRRYNPLTGQWILVSPHRAKRPWQGAQETPAKQTLPAHDPDCFLCPGNTR
VTGDTNPNYTGTYVFTNDFAALMTDTPDAPESDDPLMRCQSARGTSRVICFSPDHSKTLP
ELSLEALEDVVKTWQEQTADLGKSYPWVQVFENKGAAMGCSNPHPHGQVWANSFLPNEAE
REDRLQKEYYAAQGQPMLLDYVQRELADGSRTVVDTEHWLAVVPYWAAWPFETLLLPKAH
VQRITDLTDAQRSDLALALKKLTSRYDNLFQCSFPYSMGWHGAPFNDEDHNHWQLHAHFY
PPLLRSATVRKFMVGYEMLAETQRDLTAEQAAERLRAVSDVHFRESGV
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgagcgtatttaaccccgttgaccatccacatcgtcgttataacccgttaaccggacag
tggattctggtttctccgcatcgcgccaagcgcccctggcagggggcgcaggaaacgccg
gcaaaacagaccttgccggcccacgatccggactgtttcctgtgcccgggcaacacccgg
gtgaccggcgacaccaacccgaattacaccggtacctacgtatttaccaacgactttgcg
gccctgatgaccgacaccccggacgcaccggagagtgacgatccgctgatgcgctgccag
agcgcccgcggcaccagtcgggtgatctgcttctcgccagaccacagcaaaacgctgccg
gaactgagccttgaagcgctggaagacgtggttaaaacgtggcaggaacagaccgcggac
ctcgggaaaagctacccgtgggtgcaggtttttgaaaacaaaggggcagcgatgggctgc
tccaaccctcacccgcatggtcaggtgtgggccaacagtttcctgcccaatgaagcggaa
cgggaagaccgtctgcagaaagagtattacgccgcacagggccagccgatgctgctggac
tatgtgcagcgcgaactggccgacggcagccgcacggtggtggacaccgagcactggctg
gcggtggtgccctactgggccgcctggccgttcgaaacgctgctgttgccgaaagcgcac
gtgcagcgcattaccgatctcaccgacgcccagcgcagcgatctggcactggcgttgaaa
aagctgaccagccgttacgacaacctgttccagtgctcattcccctactccatgggctgg
cacggcgcgccgtttaacgacgaagaccataaccactggcagcttcatgcccacttttat
ccgccgctgctgcgctccgcgacggtccgcaagtttatggttggttatgagatgctggcc
gaaactcagcgcgatctgaccgccgagcaagctgccgaacgactgcgcgccgtcagcgac
gtccattttcgtgaatccggagtgtaa

DBGET integrated database retrieval system