KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH24: KPNIH24_20795
Entry
KPNIH24_20795     CDS       T03369                                 

Definition
(GenBank) galactokinase
  KO
K00849  galactokinase [EC:2.7.1.6]
Organism
kph  Klebsiella pneumoniae subsp. pneumoniae KPNIH24
Pathway
kph00052  Galactose metabolism
kph00520  Amino sugar and nucleotide sugar metabolism
kph01100  Metabolic pathways
Module
kph_M00554  Nucleotide sugar biosynthesis, galactose => UDP-galactose
kph_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:kph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    KPNIH24_20795
   00520 Amino sugar and nucleotide sugar metabolism
    KPNIH24_20795
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kph04147]
    KPNIH24_20795
Enzymes [BR:kph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.6  galactokinase
     KPNIH24_20795
Exosome [BR:kph04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPNIH24_20795
SSDB
Motif
Pfam: GalKase_gal_bdg GHMP_kinases_C GHMP_kinases_N
Other DBs
NCBI-ProteinID: AID97601
LinkDB
Position
4253552..4254700
AA seq 382 aa
MSLKEKTQTLFADAFGYPASNVIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRD
DRTVRVIAADYDNQTDEFSLDAPIISHDTQQWSNYVRGVVKHLQQRNSHFGGADLVISGN
VPQGAGLSSSASLEVAVGTVFQQLYHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISAL
GKKDHALLIDCRSLGTKAVSMPKGVAVVIINSNFKRTLVGSEYNTRREQCETGARFFQQP
ALRDVTLEQFNAVAHELDPVVAKRVRHVLTENARTVEAASALEKGDLKRMGELMAESHAS
MRDDFEITVPQIDTLVEIVKAAIGDKGGVRMTGGGFGGCVVALIPEDLVDTVQQAVANEY
EAKTGIKETFYVCKPSQGAGQC
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgagtctgaaagagaaaacccaaaccctgttcgctgacgccttcggctacccggccagc
aatgtcattcaagcgccaggccgcgtcaacctgatcggcgagcataccgattacaacgac
ggttttgtgctgccctgcgctatcgactaccagacggtgatcagctgtgcgccgcgcgac
gatcgtaccgtgcgggtgattgccgccgattacgacaatcagaccgatgagttctctctc
gacgcgccgattatcagccacgacacccagcagtggtcgaactatgtccgcggcgtggta
aagcatctgcagcagcgtaacagccactttggcggcgcggatctggtgatcagcggcaat
gtaccgcagggtgcggggttaagctcctcagcctcgctggaagtcgccgtcggcaccgtg
ttccaacagctgtatcatctgccgctggatggcgcgcaaatcgccctcaacggccaggag
gcggaaaaccagttcgtcggctgcaactgcggcatcatggatcagctgatttcagcgctg
ggcaaaaaagaccacgcgctgctgatcgactgccgttcgctgggcaccaaagccgtctcg
atgccgaaaggcgtggcggtggtgatcatcaacagcaactttaagcgtactctcgtcggc
agcgagtacaacacccgtcgtgaacagtgcgaaaccggcgcgcgcttcttccagcagccc
gccctgcgcgatgtcacccttgagcaatttaacgccgtcgcccatgagctggatccggtg
gtcgcgaagcgcgtacgccacgtgctgacggagaatgcccgcactgtggaagccgccagc
gccctcgaaaaaggcgacctgaagcggatgggtgagctgatggcagagtcccacgcctcg
atgcgtgatgatttcgagatcaccgtcccgcagatcgacaccctggtggagatcgttaag
gccgcgatcggcgataagggcggcgtgcgcatgaccggcggcggctttggcggctgcgtg
gtagcgttaatcccggaagatctggtcgataccgttcagcaggccgttgccaacgagtat
gaagcgaaaaccggtattaaagagacattctatgtctgcaaaccgtcacagggggccggg
caatgctaa

DBGET integrated database retrieval system