KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH24: KPNIH24_20800
Entry
KPNIH24_20800     CDS       T03369                                 

Gene name
galM
Definition
(GenBank) galactose-1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
kph  Klebsiella pneumoniae subsp. pneumoniae KPNIH24
Pathway
kph00010  Glycolysis / Gluconeogenesis
kph00052  Galactose metabolism
kph01100  Metabolic pathways
kph01110  Biosynthesis of secondary metabolites
kph01120  Microbial metabolism in diverse environments
Module
kph_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:kph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPNIH24_20800 (galM)
   00052 Galactose metabolism
    KPNIH24_20800 (galM)
Enzymes [BR:kph01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     KPNIH24_20800 (galM)
SSDB
Motif
Pfam: Aldose_epim
Other DBs
NCBI-ProteinID: AID97602
LinkDB
Position
4254694..4255737
AA seq 347 aa
MLTQTTALAPDGRPWQQVTLRNKSGMTVTVADWGATLLSAEVPLADGSLRRPLLGCAKLE
DYARQAAFLGASVGRYANRIGHSRFPLDGQVVNVTPSNDAGHQLHGGPEGFDKRRWRIVR
ADEQEVLFALTSPDGDQGFPGTLQATAHYRLTDDNRIAITYRATVDQPCPVNMTNHVYFN
LDGEQGDVRQHQLQILAQRYLPVESDGIPGGELKDVANTSFDFRQPKTIAADFLADADQQ
KVKGYDHAFLLDAKGDASQPAAQVWSQDGKLQMTVYTSAPALQFYSGNYLGGTPSQTTEP
YADWQGLALESEFLPDSPNHPQWPQPDCVLRPGQEYVSLTEYQFIAR
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgctaacgcaaaccaccgcgctggccccggacggccggccatggcagcaggtgaccctg
cgcaataagtcggggatgaccgtcaccgtggcggactggggcgcgacgctgctcagcgcc
gaggtgccgctggccgatggcagcctgcgccgaccgctgctgggctgcgcaaagctggaa
gactatgctcgccaggccgcatttcttggcgcctcggtaggccgctacgccaaccgtatc
ggccacagccgcttcccgcttgacggccaggtcgtcaacgtcacgccgtcaaacgacgcg
ggccaccagctccacggcggcccggaagggtttgataagcgccgctggcgcattgtccgc
gccgacgagcaggaagtgctgttcgccctgacctcgcccgatggcgatcaaggctttccg
ggcaccctgcaggccaccgcgcactatcgtctgaccgacgataaccgcatcgcgattacc
tatcgcgccaccgtggaccaaccctgcccggtgaatatgaccaatcacgtctatttcaac
ctcgacggtgagcagggcgatgtgcgccagcatcagctccagatcctcgcccagaggtat
ctgccggtggaaagcgacggtatcccgggtggcgaactgaaagatgttgctaacaccagc
tttgatttccgccagccgaaaaccatcgccgccgacttcctcgcggatgccgatcagcaa
aaggtgaagggatacgatcatgccttcctgctggatgccaaaggcgacgccagccagcct
gcggcacaggtctggtcgcaggatggcaagctgcagatgacggtctatacctccgctccg
gcgctgcagttttactccggcaactatctcggcggcaccccgtcgcagacgacggagccc
tacgccgactggcagggactggcgctggagagcgaattcctgccggattcgccgaaccat
ccgcaatggccgcagccggactgtgtattacgtccgggccaggagtacgtcagcctgacg
gaatatcagtttatcgcccgataa

DBGET integrated database retrieval system