KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH24: KPNIH24_20955Help
Entry
KPNIH24_20955     CDS       T03369                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
kph  Klebsiella pneumoniae subsp. pneumoniae KPNIH24
Pathway
kph00020  Citrate cycle (TCA cycle)
kph00190  Oxidative phosphorylation
kph00650  Butanoate metabolism
kph01100  Metabolic pathways
kph01110  Biosynthesis of secondary metabolites
kph01120  Microbial metabolism in diverse environments
kph01130  Biosynthesis of antibiotics
kph01200  Carbon metabolism
Module
kph_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kph_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
kph_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:kph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KPNIH24_20955 (sdhA)
   00650 Butanoate metabolism
    KPNIH24_20955 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    KPNIH24_20955 (sdhA)
Enzymes [BR:kph01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     KPNIH24_20955 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     KPNIH24_20955 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: AID97624
LinkDB All DBs
Position
complement(4280163..4281929)
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNS
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEKGEDVVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGLHLQ
ESIAEQGTLRDASESDIEGSLDRLNRWNNTRSGEDPVAIRKALQECMQHNFSVFREGDAM
HKGLEQLKVIRERLKNARIDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAH
SRFDFPDRDDENWLCHSLYLPESESMTRRSVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgccagtcagagagtttgatgctgttgtcatcggtgccggcggcgcaggtatg
cgcgcggcgctgcaaatttcccagagcggacagacttgtgcactgctctccaaagtgttc
cctacccgttcccataccgtatccgcgcagggtggcatcaccgtcgcgctcggtaactcc
catgaagataactgggaatggcatatgtacgacaccgtaaaagggtcggactatatcggc
gaccaggacgccatcgaatacatgtgtaagaccggcccggaagcgattcttgagctggag
cacatgggactgccgttctctcgtcttgacgatggccgtatttatcagcgcccgtttggc
ggccagtcgaagaacttcggcggcgaacaggcggcgcgtaccgcggcggcggctgaccgt
accggtcacgccctgctgcacactctgtatcagcagaacctgaaaaaccacaccactatc
ttctccgaatggtacgccctcgatctggtgaaaaaccaggacggcgcggtagtcggttgt
accgccctgtgcatcgagaccggcgaagtggtctactttaaagcccgcgccaccgtgctg
gcgaccggcggcgcaggccgtatctatcagtccaccaccaacgcccacatcaatacgggt
gacggcgtcgggatggccatccgcgccggcgtgccggtgcaggatatggaaatgtggcag
ttccacccgaccggtatcgccggggctggggttctggttaccgaaggttgccgcggcgaa
ggcggttacctgctgaacaaacacggcgaacgctttatggagcgttatgccccgaacgct
aaagacctggcgggccgtgacgtggtggcgcgttccatcatgatcgaaatccgcgaaggc
cgcggttgcgacggtccgtggggcccgcacgcgaaactgaaactggatcacctcggtaaa
gaggttctggaatctcgtctgccgggtatccttgaactttcccgtacctttgcccacgtc
gatccggtgaaagagccgatcccggttatcccaacctgtcactacatgatgggcggtatc
ccgaccaaagtcaccggccaggcgttgaccgtgaatgagaagggcgaagacgtggtgatc
ccgggcctgttcgcggtaggcgaaatcgcctgcgtatcggtccacggcgccaaccgtctg
ggcggcaactcgctgctcgacctggtggtcttcggccgcgcggcgggcctgcatctgcag
gaatccattgccgagcagggcacgctgcgcgacgccagcgaatccgatatcgaaggctcg
ctggatcgcctcaaccgctggaacaacacccgctctggtgaagatccggtggcgattcgt
aaagcgctgcaggaatgtatgcagcataacttctcggtgttccgcgaaggcgatgcgatg
cacaaaggtctggagcaactgaaagtgatccgcgagcgcctgaaaaacgcccgtatcgac
gatacctccagcgagttcaacacccagcgcgttgagtgcctggagctggataacctgatg
gaaaccgcctacgcgaccgccgtatccgctaacttccgtaccgagagccgtggcgcccac
agccgcttcgacttcccggatcgtgatgatgaaaactggctgtgccattccctgtacctg
ccagagtcggaatccatgacgcgtcgtagcgtcaatatggaaccgaaactgcgtccggca
ttcccgccgaagattcgtacttactaa

DBGET integrated database retrieval system