KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH24: KPNIH24_21065
Entry
KPNIH24_21065     CDS       T03369                                 

Definition
(GenBank) phosphoglucomutase
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
kph  Klebsiella pneumoniae subsp. pneumoniae KPNIH24
Pathway
kph00010  Glycolysis / Gluconeogenesis
kph00030  Pentose phosphate pathway
kph00052  Galactose metabolism
kph00230  Purine metabolism
kph00500  Starch and sucrose metabolism
kph00520  Amino sugar and nucleotide sugar metabolism
kph00521  Streptomycin biosynthesis
kph01100  Metabolic pathways
kph01110  Biosynthesis of secondary metabolites
kph01120  Microbial metabolism in diverse environments
Module
kph_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
kph_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:kph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPNIH24_21065
   00030 Pentose phosphate pathway
    KPNIH24_21065
   00052 Galactose metabolism
    KPNIH24_21065
   00500 Starch and sucrose metabolism
    KPNIH24_21065
   00520 Amino sugar and nucleotide sugar metabolism
    KPNIH24_21065
  09104 Nucleotide metabolism
   00230 Purine metabolism
    KPNIH24_21065
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    KPNIH24_21065
Enzymes [BR:kph01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     KPNIH24_21065
SSDB
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Other DBs
NCBI-ProteinID: AID97645
LinkDB
Position
complement(4303141..4304781)
AA seq 546 aa
MAIDKRAGQPAQQSDLINVAQLTAQYYVLKPEVGNAEHAVKFGTSGHRGSAARHNFNEPH
ILAIAQAIAEDRAKNGITGPCYVGKDTHALSEPAFISVLEVLTANGVDVIVQENNGFTPT
PAVSNAILVHNKKGGPLADGIVITPSHNPPEDGGIKYNPPNGGPADTNVTKVVENRANEL
LAAGLQGVKRISLDAALASGHVKEQDLVQPFIEGLADIVDMAAIQKAGLTLGVDPLGGSG
IEYWKRIGEHYKLNLTIVNDQVDQTFRFMHLDKDGAIRMDCSSECAMAGLLALRDKFDLA
FANDPDYDRHGIVTPAGLMNPNHYLAVAINYLFQHRPQWGKEVAVGKTLVSSAMIDRVVN
DLGRKLVEVPVGFKWFVDGLFDGSFGFGGEESAGASFLRFDGTPWSTDKDGIIMCLLAAE
ITAVTGKNPQEHYNELAERFGAPSYNRLQASATSAQKAALSKLSPEMVSADTLAGDPITA
RLTAAPGNGAAIGGLKVMTDNGWFAARPSGTEDAYKIYCESFLGEEHRKLIEKEAVEIVS
EVLKNA
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggcaatcgataaacgtgcggggcagcctgcgcaacagagtgatttgattaacgtcgcc
caactgactgctcagtactacgtgctgaagcctgaagtcggtaatgcggagcatgcggta
aaattcggcacctctggccatcgcggtagcgcggcgcgccacaacttcaacgaaccgcat
atcctggccatcgcccaggccattgcggaagatcgtgcgaaaaacgggatcaccggtccg
tgctatgtcggcaaagatacccacgccctctccgagccggcgtttatttcggtgctggaa
gtgttaaccgccaacggcgtcgacgtgatcgtgcaggaaaacaacggcttcaccccgacg
ccggcggtctccaacgcgattctggtgcataacaaaaaaggcggtccgctggcggacggc
attgtgatcaccccgtcacacaacccgccggaagatggtggtatcaagtacaatccgcca
aacggcggcccggctgataccaacgtcaccaaagtggtggaaaaccgcgccaacgaactg
ctggccgcgggcctgcagggcgtgaaacgcatttctctggacgcggcgctggcttctggc
cacgttaaagaacaggatctggtgcagccgttcattgaggggctggcggatatcgtcgat
atggccgcaatccagaaagccggcctgacgctgggcgtcgatccgctgggcgggtccggt
atcgaatactggaagcgcattggcgagcactacaagctcaatctgaccattgttaacgat
caggtggatcagaccttccgctttatgcacctcgataaagacggcgccatccgcatggat
tgctcctcagagtgtgcgatggccggcctgctggcgctgcgcgataagttcgatctggcg
tttgctaacgacccggattacgaccgccacgggattgtcaccccggcggggttgatgaac
ccgaaccactacctggcggtagcgatcaactacctgttccagcatcgtccgcagtggggc
aaagaggtggcggtgggtaaaacgctggtctcctccgcgatgattgaccgcgtggtgaac
gatctgggccgcaagctggtggaagtgccggtgggctttaagtggtttgtcgacggcctg
ttcgatggcagcttcggcttcggcggcgaagagagcgccggggcctccttcctgcgcttc
gacggcacgccgtggtccaccgataaagacggcatcatcatgtgcctgctggcggcggaa
atcaccgcggtgaccgggaaaaacccgcaggagcattacaacgaactggcggaacgcttc
ggtgcgccgagctataaccgtctgcaggcttccgcgacctccgcgcagaaagcggcgctg
tccaagctctctccggaaatggtcagcgctgacaccctggcgggggatccgatcactgcc
cgtctgaccgcggcgccgggcaacggggcggcgattggcggcctcaaggtgatgaccgac
aacggctggttcgcggcgcgtccgtcaggcaccgaagacgcctacaagatctactgcgaa
agcttcctcggcgaagagcatcgcaagctgattgaaaaagaagcggtagagattgtcagc
gaagtgctgaagaacgcttaa

DBGET integrated database retrieval system