KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH24: KPNIH24_23490Help
Entry
KPNIH24_23490     CDS       T03369                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
kph  Klebsiella pneumoniae subsp. pneumoniae KPNIH24
Pathway
kph00473  D-Alanine metabolism
kph00550  Peptidoglycan biosynthesis
kph01100  Metabolic pathways
kph01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:kph00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    KPNIH24_23490
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KPNIH24_23490
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    KPNIH24_23490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kph01011]
    KPNIH24_23490
Enzymes [BR:kph01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     KPNIH24_23490
Peptidoglycan biosynthesis and degradation proteins [BR:kph01011]
 Precursor biosynthesis
  Amino acid ligase
   KPNIH24_23490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: AID98101
LinkDB All DBs
Position
4790727..4791824
Genome map
AA seq 365 aa AA seqDB search
MAKMRVGIVFGGKSAEHEVSLQSAKNIVEAIDKSRFDVVLLGIDKQGLWHINDAGNYLLN
AQDPARIALRPSTVTLAQIPGREAQQLINAESGQPLAAIDVIFPIVHGTLGEDGSLQGML
RMANLPFVGSDVLGSAACMDKDVTKRLLRDAGLAVAPFITLTRANRAQFSFADVEAKLGL
PLFVKPANQGSSVGVSKVKNEEQYHQAVALAFEFDHKVVVEQGIKGREIECAVLGNDHPQ
ASTCGEIVLNSEFYAYDTKYIDDQGAQVVVPAAIAPEINDKIRAIAVQAYQTLGCSGMAR
VDVFLTADNEVVINEINTLPGFTNISMYPKLWQASGLDYTSLITRLIELALERHAADRAL
KTSMN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagatgagggttgggatcgtttttggcggcaagtcggcggagcatgaagtgtcg
ctgcagtcagcgaagaatatcgtggaagcgattgataaatcgcgcttcgatgtggttctg
ttgggtattgataaacaggggctgtggcatatcaacgacgccggcaactacctgctcaac
gcacaggatcctgcccgcattgccctgcgcccttccacggtgactctggcgcagatcccg
ggccgcgaagcgcagcagctgattaacgccgaaagcggccaaccgctggcggccatcgat
gtgattttcccgatcgtccacggcacgctgggtgaagatggctccctgcaggggatgctg
cgcatggcgaatctgccgttcgtcggctccgatgtgctgggctctgcggcctgtatggac
aaagacgtgaccaaacgtctgctgcgcgacgccgggctcgccgtcgccccgtttatcaca
ctcacccgcgccaaccgcgcgcagttcagctttgccgatgtcgaagcgaagcttggcctg
ccgctgttcgttaagccggctaatcagggctcgtcggttggcgtcagcaaagttaaaaac
gaagagcagtaccatcaggcggtggccctggccttcgaatttgaccataaagtggtggtg
gagcaaggcattaaagggcgggaaattgagtgtgcggtgctgggtaacgaccacccgcag
gccagcacctgcggtgaaatcgtcctcaacagcgagttttacgcctacgacaccaagtat
atcgacgatcagggcgcacaggtggtagtcccggccgctatcgcccctgagatcaacgac
aaaattcgcgctatcgcggtgcaggcctaccagaccctgggctgcagcggcatggctcgt
gtcgacgtgttcctcaccgccgacaacgaggtggtgatcaacgagatcaacaccctgccg
ggctttaccaacatcagcatgtatccgaagctgtggcaggccagcggtctcgactacacc
agcctgatcacccgcctgattgagctggcgttggagcgccatgccgcggaccgggcgctg
aaaacctccatgaactaa

DBGET integrated database retrieval system