KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH24: KPNIH24_23880Help
Entry
KPNIH24_23880     CDS       T03369                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
kph  Klebsiella pneumoniae subsp. pneumoniae KPNIH24
Pathway
kph00250  Alanine, aspartate and glutamate metabolism
kph00280  Valine, leucine and isoleucine degradation
kph00310  Lysine degradation
kph00410  beta-Alanine metabolism
kph00640  Propanoate metabolism
kph00650  Butanoate metabolism
kph01100  Metabolic pathways
kph01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    KPNIH24_23880
   00650 Butanoate metabolism
    KPNIH24_23880
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KPNIH24_23880
   00280 Valine, leucine and isoleucine degradation
    KPNIH24_23880
   00310 Lysine degradation
    KPNIH24_23880
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KPNIH24_23880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kph01007]
    KPNIH24_23880
Enzymes [BR:kph01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     KPNIH24_23880
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     KPNIH24_23880
    2.6.1.48  5-aminovalerate transaminase
     KPNIH24_23880
Amino acid related enzymes [BR:kph01007]
 Aminotransferase (transaminase)
  Class III
   KPNIH24_23880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AID98175
LinkDB All DBs
Position
4870200..4871483
Genome map
AA seq 427 aa AA seqDB search
MNSNKAMMARRSDAVPRGVGQIHPIFAERAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
QVVAAVEDQLKKLSHTCFQVLAYEPYLALCEKMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATGRSGAIAFTGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALYPCALHGVSD
DEAIASIHRIFKNDAAPEDIAAIIIEPVQGEGGFYAASPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAADITTFAKSIAGGFPLAGVTGRAEVMDAIAPGGLGGTYAG
NPIACAAALAVLQIFEQENLLEKANQLGDTLRQGLLAIAEDHPEIGDVRGLGAMIAIELF
EEGDRSRPNARLTADIVARARDKGLILLSCGPYYNVLRILVPLTIEEAQIEQGLKIIADC
FSEAKQA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaataaagcaatgatggcgcgtcgcagcgacgcggtcccgcgcggcgtcggc
cagatccaccctatcttcgccgaacgcgcggagaactgccgggtgtgggacgtggaaggc
cgggaatatctcgattttgccggcggtatcgcggtgctcaataccggccacctgcatccg
caggttgtcgccgccgtcgaagaccagctgaaaaagctgtcgcatacctgcttccaggtg
ctggcctatgagccttatctggcgctgtgcgaaaagatgaatcaaaaggtgcccggtgat
ttcgccaagaaaaccctgctggtcaccaccgggtcggaagcggtggagaacgcggtgaag
atcgcccgcgcggcaaccgggcgcagcggcgctatcgccttcaccggcgcctatcacggc
cgcacccattacaccctgtcgctgaccggcaaagtgaatccttactccgccggtatgggc
ttaatgccgggccatgtctatcgcgccctctacccatgcgcgctgcacggcgtcagtgat
gacgaggcgatcgccagcatccatcgcatcttcaaaaacgatgccgcgccggaagatatc
gccgccatcattattgagccggtgcagggtgaaggcgggttctatgccgcctccccggcc
tttatgcagcgcctgcgcgccctgtgcgacgagcacggcattatgctcatcgccgatgag
gtccagagcggcgcgggccgcaccggtaccctgttcgccatggagcagatgggcgtcgcg
gcggatatcaccaccttcgccaaatccatcgccggcggtttcccgctggcgggcgtcacc
ggccgcgcggaggtgatggacgccatcgcccccggcggactgggcggcacctacgccggc
aaccccatcgcctgcgccgccgccctggcggtattacagattttcgagcaggagaatctg
ctggaaaaagccaaccagctcggcgacaccctgcgccagggcctgctggcgatcgctgaa
gatcatccggagatcggcgacgtgcgcggtctgggggcgatgatcgccattgagctgttt
gaagagggcgaccgcagcaggccgaacgccaggctgacggcggatatcgtcgcccgcgcc
cgcgacaaaggcctgatcctgctctcctgcgggccgtactacaacgtgctgcgcatcctg
gtgccgctgaccatcgaagaggcgcagatcgagcaggggctcaagatcatcgccgactgc
tttagcgaggcgaaacaggcatag

DBGET integrated database retrieval system