KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH24: KPNIH24_26195
Entry
KPNIH24_26195     CDS       T03369                                 

Definition
(GenBank) galactonate dehydratase
  KO
K01684  galactonate dehydratase [EC:4.2.1.6]
Organism
kph  Klebsiella pneumoniae subsp. pneumoniae KPNIH24
Pathway
kph00052  Galactose metabolism
kph01100  Metabolic pathways
kph01120  Microbial metabolism in diverse environments
Module
kph_M00552  D-galactonate degradation, De Ley-Doudoroff pathway, D-galactonate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:kph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    KPNIH24_26195
Enzymes [BR:kph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.6  galactonate dehydratase
     KPNIH24_26195
SSDB
Motif
Pfam: MR_MLE_C MR_MLE_N
Other DBs
NCBI-ProteinID: AID98625
LinkDB
Position
complement(5348632..5349780)
AA seq 382 aa
MKITNITTYRLPPRWMFLKIETDEGIVGWGEPVIEGRARTVEAAVHEFGDYLIGQDPARI
NDLWQVMYRGGFYRGGPIMMSAIAGIDQALWDIKGKVLNAPVWQLMGGLVRDKIKAYSWV
GGDRPAEVIDGIKKLRGIGFDTFKLNGCEEMGIIDNSRAVDAAVNTVAQIREAFGNEIEF
GLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAEYYPRLAAQTHIPIAAGERMFSR
FEFKRVLEAGGVAILQPDLSHAGGITECYKIAGMAEAYDVGLAPHCPLGPIALAACLHVD
FVSHNAVFQEQSMGIHYNKGAELLDFVKNKEDFNMEGGFFKPLMKPGLGVEIDEARVIEL
SKNAPDWRNPLWRYEDGSVAEW
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgaaaataaccaatatcaccacgtaccgtttacctccgcgttggatgttcctgaagatt
gaaaccgatgaaggcatcgtcggctggggcgaaccggtgattgaagggcgcgcccgtacg
gtggaggcagccgttcatgaatttggcgattacctgattggtcaggatccggcgcggatt
aatgacctgtggcaggtaatgtaccgcggcggcttttatcgcggcggcccgattatgatg
agcgccatcgccggtattgatcaggcgctatgggatattaaaggtaaggtcctgaatgcc
ccagtgtggcaactgatgggcgggctggtgcgcgacaaaattaaagcctacagctgggtg
ggcggcgaccgccccgccgaagtgattgacgggattaagaagctgcgcggcattggtttt
gacacctttaaattaaacggctgcgaagagatgggtatcattgataattcccgcgcggtt
gatgccgcggtgaataccgtggcgcaaatccgcgaagcgtttggcaatgaaattgagttt
ggtctcgattttcacggccgcgttagcgcgccgatggctaaggtattaattaaagagctg
gagccatatcgcccattatttattgaggagccggtattagccgagcaggcggaatattat
ccgcggctggcggcgcaaacccatattcccattgccgccggcgaacgtatgttttcgcgc
tttgaatttaaacgggtcctggaagcgggcggggtggctattttacaacccgatctgtcg
cacgcaggcggtattaccgaatgctataaaattgccggcatggcggaagcctatgacgtt
gggctggcgccgcactgcccgctggggccgatcgcgctggcggcttgtctgcacgttgat
ttcgtttcacataacgcggtcttccaggagcagagcatggggatccactacaacaaaggc
gccgaactgcttgattttgtgaaaaacaaagaagatttcaatatggaaggcggcttcttt
aaacctctgatgaagccggggctgggcgtggaaattgatgaggcccgcgtgattgagtta
agtaaaaacgcgccggactggcgaaatccgttgtggcggtatgaggatggatctgtcgcc
gaatggtaa

DBGET integrated database retrieval system