KEGG   Kibdelosporangium phytohabitans: AOZ06_10750Help
Entry
AOZ06_10750       CDS       T04088                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
kphy  Kibdelosporangium phytohabitans
Pathway
kphy00250  Alanine, aspartate and glutamate metabolism
kphy00410  beta-Alanine metabolism
kphy00430  Taurine and hypotaurine metabolism
kphy00650  Butanoate metabolism
kphy01100  Metabolic pathways
kphy01110  Biosynthesis of secondary metabolites
kphy01120  Microbial metabolism in diverse environments
kphy02024  Quorum sensing
Module
kphy_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:kphy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AOZ06_10750
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AOZ06_10750
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AOZ06_10750
   00430 Taurine and hypotaurine metabolism
    AOZ06_10750
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AOZ06_10750
Enzymes [BR:kphy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AOZ06_10750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ALG07339
UniProt: A0A0N9HZL8
LinkDB All DBs
Position
complement(2346173..2347546)
Genome map
AA seq 457 aa AA seqDB search
MALAHPSRGPEPGPSEVSVNPLYARVPTHIPKNELPAGGLDPDLAYQVVHDELMLDGNAR
LNLATFVTTWMEPTAEKLMAECFDKNMIDKDEYPRTAELEARCVRMLAGLWHAPSVTDAP
GCSTTGSSEACMLAGLALKRRWRNRGGPGRPNIVMGVNVQVCWEKFANYWDVDARLVPMD
GDRFHLSAEEAVKLCDENTIGVVAVLGSTFDGSYEPVEEICRALDEVQAGTGLDIPVHVD
GASGAMIAPFCDPDLRWDFRLPRVASINTSGHKYGLVYPGVGWVVWRDTQALPEDLVFRV
NYLGGTMPTFALNFSRPGSQVVTQYYNFLRLGFDGYRRVQQACRDVATSLAARIAELGPL
TLLTKGDELPVFAFTVAEGQPFSVFNVSTALRARGWQVPAYTFPANRTDLAALRIVVRNG
FSPDLADALLADLKQVLPALATLDHPKPGPSAFAHGT
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggcacacccgtcccgtgggcccgaaccgggcccgtccgaggtatcggtcaac
cccttgtacgccagggtgccgacgcacatcccgaagaacgagctgcctgccggtggcctc
gacccggacctggcctaccaggtcgtgcacgacgagctgatgctggacggcaacgcccgg
ctcaacctggcgacgttcgtgaccacgtggatggagccgacggccgagaagctgatggcc
gagtgcttcgacaagaacatgatcgacaaggacgagtacccgcgcacggccgagctggag
gcgcgctgtgtgcggatgctcgccgggctgtggcacgcgccgagcgtcaccgacgccccc
ggctgctcgaccaccggttccagcgaggcctgcatgctcgccgggctcgcgttgaaacgg
cgctggcgaaatcgcggcgggccgggcaggccgaacatcgtgatgggcgtcaacgtccag
gtgtgctgggagaagttcgccaactactgggacgtcgacgcccggctcgtgccgatggac
ggcgaccggttccacctgtccgccgaagaggccgtcaagctgtgcgacgagaacaccatc
ggtgtcgtggccgtcctcgggtccacattcgacggcagctacgagccggtcgaggagatc
tgccgggcgctcgacgaggtgcaggccggcaccgggctggacatcccggtgcacgtggac
ggcgcgtccggcgcgatgatcgcgccgttctgcgatccggatctgcggtgggacttccgg
ctgccgcgcgtcgcgtcgatcaacacgtccggccacaagtacggactggtgtacccgggt
gtcggctgggtggtgtggcgtgacacgcaggccctgcccgaggacttggttttccgggtg
aactatctcggcggcacgatgccgacgttcgcgctgaacttctcccggcccggatcccag
gtcgtcacgcagtactacaacttcctgcggctggggttcgacggataccggcgcgtgcag
caggcctgccgggacgtggccacctcgctcgcggcgcggatcgccgaactgggcccgtta
acgctgctcaccaagggcgacgagttgccggttttcgcgttcacggtcgccgagggccag
ccgttctcggtgttcaacgtgtccaccgcgctgcgcgctcgcggctggcaggtgcccgcg
tacaccttccccgccaaccgcactgatctggctgcgctgcggatcgtggtgcgcaacggt
ttcagccccgacttggccgacgcgctgctggccgacctgaaacaggtgctgcccgcgctc
gccacgctcgatcacccgaaaccggggccgtcggctttcgcgcacggcacgtga

DBGET integrated database retrieval system