Kibdelosporangium phytohabitans: AOZ06_13010 Help Entry AOZ06_13010       CDS       T04088                                  Name (GenBank) hypothetical protein   KO K02503   histidine triad (HIT) family protein [EC:3.9.1.-] Organism kphy  Kibdelosporangium phytohabitans Brite KEGG Orthology (KO) [BR:kphy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:kphy03016]     AOZ06_13010   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:kphy04147]     AOZ06_13010 Transfer RNA biogenesis [BR:kphy03016]  Eukaryotic type   Aminoacyl-tRNA synthetases (AARSs)    AARS associated factors     AOZ06_13010 Exosome [BR:kphy04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    AOZ06_13010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HIT DcpS_C Mob_Pre Motif Other DBs NCBI-ProteinID:  ALG14756 UniProt:  A0A0N9IIB0 LinkDB All DBs Position complement(2792376..2792648) Genome browser AA seq 90 aa AA seqDB search MHAAHALVIPRVHVADAAEDPIVTGAVMARAAELLAEHTDGNLITSRGVHSSQTVYHLHV HVVPRSESDGLPLPWTRQQQDRAARAVACG NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgcacgcggctcacgctctggtgatcccgcgcgtgcatgtggcggacgcggccgaggac ccgatcgtgaccggtgccgtgatggcccgtgccgcggagctgctggccgagcacaccgac ggcaacctgatcaccagccgcggtgtccacagcagccagacggtctaccacctgcatgtg cacgtcgtgccgagatccgagagtgacggcttgccgctgccgtggacacgtcagcaacag gaccgggctgcacgggcggtggcgtgtggctga

DBGET integrated database retrieval system