KEGG   Kibdelosporangium phytohabitans: AOZ06_14620Help
Entry
AOZ06_14620       CDS       T04088                                 

Definition
(GenBank) myo-inositol-1-monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
kphy  Kibdelosporangium phytohabitans
Pathway
kphy00521  Streptomycin biosynthesis
kphy00562  Inositol phosphate metabolism
kphy01100  Metabolic pathways
kphy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:kphy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AOZ06_14620
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AOZ06_14620
Enzymes [BR:kphy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     AOZ06_14620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: ALG07985
UniProt: A0A0N9I034
LinkDB All DBs
Position
3148479..3149285
Genome map
AA seq 268 aa AA seqDB search
MVHLRDTLRRVAVRVATEAAELVETTRRSAVRHVETKSSATDPVTAGDRAAERLVRERLA
ELRPGDPVLGEEEGAGGSGAADGAVTWVVDPIDGTVNYLYGLPWYSVSVAAQVDGVTVAG
AVVEPASGRVWSAARGEGATLDDVPLRASTASELELTLVATGFAYRQERRAQQTGVIARL
LTEIRDIRRTGSAALDLCMVGAGWVDAYFEVGLSPWDWAAGSLIAEEAGAVVHLPGTGEL
GNAVFASAPGVADPLRRLLVDAGLPGVR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggtccatctgcgggacaccttgcgccgagtcgccgtccgggtggcgaccgaggcggcc
gaactggtcgagacgacccggcgttcggccgtccggcacgtcgagaccaagtccagcgcg
accgacccggtgaccgcgggtgaccgggcggccgagcgcctcgtgcgcgagcggctggcg
gaactgcggcccggcgatccggtgctcggcgaggaagagggagcaggcggctccggcgcc
gccgacggggccgtgacctgggtcgtcgaccccatcgacggcaccgtgaactacctctac
ggcctgccctggtacagcgtgtcggtcgcagcgcaggtggacggggtgacggtggccggg
gccgtagtcgagcccgccagcggccgtgtgtggtcggctgcgcggggcgagggcgccacc
ctggacgacgtgccgctgcgggcgagcaccgcgagtgagctggaactgacgctggtcgcc
acggggttcgcctaccggcaggagcggcgggcccagcagaccggggtgatcgcgcgcctg
ctgaccgagatacgtgacatacgtcgcaccggctcggccgcgctggacctgtgcatggtc
ggcgccggctgggtggacgcgtacttcgaggtcggcctcagcccgtgggactgggcggcc
gggtcgttgatcgccgaggaggcgggagcggtcgtgcacctgcccggcacgggcgaactg
gggaacgcggtcttcgcgtcggcgcccggcgtcgcggacccgctcaggcggctcctggtc
gacgccgggcttcccggcgttcggtga

DBGET integrated database retrieval system