KEGG   Kibdelosporangium phytohabitans: AOZ06_18075Help
Entry
AOZ06_18075       CDS       T04088                                 

Definition
(GenBank) hypothetical protein
Organism
kphy  Kibdelosporangium phytohabitans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: ALG08571
UniProt: A0A0N9HZ00
LinkDB All DBs
Position
3924939..3926618
Genome map
AA seq 559 aa AA seqDB search
MSHDKTADHAQLTGWLDDPADDRGVRFRQDDGSWSRLTYRELADRVVRAGAALADAGVRK
GDVVPLVLPTGEDFVSQFFGLLAIGATPSVLPLPQAIRGGEGYTNQLRAIAGRIVPKHIV
VDHRYSEVIRESSDELKTGAVLLEPVHADRADEAPRAYGELAVLQFTSGSRGTPRGLRIT
IANLAANLRMISGWMANTHYGAVTWLPLYHDMGLIGGLLGGLTSQLEHALMRPEQFIRDT
KGWLTEYGHTPYQSMCMPNFGFERVLARTKPEHLEGMDFSHVRSVISGAERIDPAVLSRF
VRLLEPHGFEASALMPAYGLAEGTLAVTGIGPLETPRLVKVSGIERRLGEKLDIREVTEL
TADPVDEPWLWQVSCGRALADTRVDILDEELSPQPEGVLGEIYVEGPAVADGYLDPTPED
RAKLSDGKLYTGDAGFVLDGELYVVGRLGDSVKINGQSVFVEDIELELAAGDTISRQHAT
VVAGMAGSVPTVLVVTERPLGEQLDEALAIVRSFAGDAAHTEVLHVKSGTIPRTSSRKPR
RRALWLSYVAGELKERVKA
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcacgacaagacggccgaccacgcccagctcacgggctggctggacgacccggcg
gacgaccgcggtgtgcggttccgccaggacgacggatcgtggtcacggctgacctaccgg
gaactggccgaccgcgtggtgcgagcgggcgcggcgctggccgacgccggtgtgcgcaag
ggcgacgtggtgccgctggtgctgcccaccggcgaggacttcgtgtcgcagttcttcggg
ctgctcgcgatcggcgcgacaccgtcggtgctgccgttgccgcaggccatccggggcggt
gagggctacaccaaccagctgcgcgcgatcgccgggcggatcgtgccgaagcacatcgtc
gtcgatcaccgctactccgaggtcatccgcgagagcagcgacgagctgaagaccggcgct
gtcctgctggagccggtgcacgccgaccgcgccgacgaggcgcctcgcgcctacggtgag
ctcgcggtgctgcagttcacctcgggttcccgcgggacaccccgcgggctgcgtatcacg
atcgccaacctggctgcgaacctgcggatgatctccggctggatggccaacacccactac
ggcgccgtcacgtggctgccgctgtaccacgacatgggcctgatcggcgggctgctcggc
ggcctgaccagccagctcgaacacgcgctgatgcgtcccgagcagttcatccgggacacc
aagggctggctgaccgagtacgggcacacgccgtaccagagcatgtgcatgcccaacttc
gggttcgagcgggtgctcgcgcgcacgaagccggaacacctcgaaggcatggacttctcg
cacgtgcgctcggtgatcagcggtgccgagcggatcgaccccgcggtgctgtcgcggttc
gtgcgcctgctggagccgcacgggttcgaggcctcggcgctgatgcccgcctacggtttg
gccgagggaacgctggcggtcaccgggatcggcccgctcgagacgccgcgcctggtgaag
gtcagcgggatcgagcgcaggctcggcgagaaactggacatccgcgaggtcaccgaactg
accgcggacccggtcgacgagccgtggctgtggcaggtcagctgcgggcgcgcgctcgcg
gacacccgcgtggacatcctggacgaggaactgtcgccgcagccggaaggcgtgctcggc
gagatctacgtcgagggacccgcggtggcggacggctacctcgacccgactcccgaggac
cgggccaagctcagcgacggcaagctctacaccggcgacgccgggttcgtgctcgacggc
gagctgtacgtggtcgggcggctcggcgacagcgtgaagatcaacgggcagagcgtgttc
gtggaggacatcgaactggaactggccgcgggcgacacgatctcccgtcagcacgcgacc
gtcgtcgccgggatggcgggctcggtgcccaccgtgctcgtggtcaccgaacggccgctg
ggcgagcagctcgacgaggcactggcgatcgtgcgctcgttcgcgggcgacgccgcgcac
accgaggtcctgcacgtcaagtccggcaccatcccgcggacctccagccgcaaaccgcgc
cgccgcgcgctttggctgtcctatgtggccggtgagctgaaggagcgggtgaaggcatga

DBGET integrated database retrieval system