KEGG   Kibdelosporangium phytohabitans: AOZ06_19375Help
Entry
AOZ06_19375       CDS       T04088                                 

Definition
(GenBank) hypothetical protein
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
kphy  Kibdelosporangium phytohabitans
Pathway
kphy00511  Other glycan degradation
kphy00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:kphy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    AOZ06_19375
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AOZ06_19375
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:kphy02042]
    AOZ06_19375
Enzymes [BR:kphy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     AOZ06_19375
Bacterial toxins [BR:kphy02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   AOZ06_19375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Laminin_G_3 BNR_2 Laminin_G_2 Laminin_G_1 BNR DUF1080 DUF4185
Motif
Other DBs
NCBI-ProteinID: ALG08787
UniProt: A0A0N9HUT3
LinkDB All DBs
Position
4227785..4230880
Genome map
AA seq 1031 aa AA seqDB search
MLPATAAASGVAPSTALVGVQQVLYRGGTAGYGCFRIPVMARTTAGTLLAFAEARKSPSC
ADRGDVDLVVRRSTNDGRTWGPIRVVTSGSPQDPDAPHTRGNAVPVMDAETGKVNLISTS
NEATPTGKRLPWIQRSADDGLTWTAPKPLGASFDGTNNGWFATGPAHGIQLENGPHKGRL
VVGAHQKPNATTVLAGVLYSDDHGDSWRASTVPNSYVDGQLSPGEIAVAELPDGSLYAAA
RNEIPTGHHRARAVSTDGGTTMPKFAAIPSLVSPNVQGSILPLRRTYRGTPGDVIVFAGP
SDPDDREKLKIRYSTDRGTTWSSPPGGLVTNDRSGYSDLAELTGGEIGVLYEGGVAFSAD
EIRFTRFTPGQLGLPGTTHGTPSPQPSTPAGPTTPDSTPEANDAYLRGNASLNDGLLLDG
TGGYAEIPYSRTIDPGAGDFTISTRFRHSATQTGPNQALFWGYGVGASAAQVWLRVQPGS
DQIAAWVQGQSGHAYLTLADPSAATAFGDDKWHQLTLTRTGSQVTVTIDGVSATGSGVAG
PVSTGVTGLRLGAKPDGTDAFAGRLGNFQLSRQGKPSLDLAFRTVDGAAVPARAPAPITD
DVSGHCATASLLGGKQSPVDGRAPNSVALPVNTAHPGVETAFSPTLDLGSGDFTFAAWFR
YSGAANQAIVWAYGTTAGKRSVWVRAQPGQDRLHAWVQTDTAQVAIPLVDTTSRVAFGDN
QWHLLALTRTGDQVQLSVDGGTPASATGLTGSVSGDQADAIRGLRLGSKMDGTDVVQGAL
DDFRLYRRALTATELGQAATGRFPADLPALWWTFEGQHTQAHDVAEPITGPQTSDASTHC
AHATVSGNPAVVPGKVGNAVRFDGVDDAVYMPYKPSIAVGDGDFTVSTWLRYTGTGDQVV
FWAYGSGATERGLWMRGQPGKDRLLVYLQTDTGAYEAAAVDASAAAGFNDGAWHFVEVSR
HAGTLTLSVDGNRLGSTAVSGSATYGDAFAVQGFRLGAKPDGTNRLTGTLDEFQIRRGAA
LAAHLPLNAAS
NT seq 3096 nt NT seq  +upstreamnt  +downstreamnt
gtgttaccggcaaccgcggcggccagcggcgtcgccccgtcgaccgcgctggtcggcgtg
cagcaagtgctctaccgcggcgggacggccgggtacgggtgtttccggatcccagtcatg
gcaaggaccacggcgggcacgctgctggccttcgccgaggcccgcaagtcgccgtcgtgc
gccgaccggggcgacgtcgacctggtggtgcgccggtcgaccaacgacggccggacctgg
ggaccgatccgagtcgtgacgtccggctcaccacaggacccggacgcgccgcacacccgc
ggcaacgcggtccctgtgatggacgccgagaccggcaaggtcaacctgatcagcacatcc
aacgaggcgacgcccaccggcaagcggctgccgtggatccagcggagcgccgacgacggc
ctcacctggaccgcgcccaaaccgctgggagccagcttcgacgggacgaacaacggctgg
ttcgccaccggccccgcgcacggcatccaactggagaacggcccgcacaagggccgcctt
gtcgtcggcgcgcaccagaaaccgaacgccacgaccgtcctcgcgggcgtgctgtacagc
gacgaccacggcgacagctggcgagccagcacagttccgaactcctatgtggatggtcag
ctcagcccgggggagatcgcggtcgcggaactgcccgacggatcgctgtacgcggccgct
cgcaacgagatccccaccggacaccaccgggccagggcggtcagcaccgacggcggcacc
accatgccgaagttcgccgcgatcccgtcgctggtgtcgccgaacgtccaaggctcgatc
ctgccgctgcgcaggacctaccgcggcacacccggtgacgtcatcgtcttcgcgggcccg
tcggacccggacgaccgggagaagctgaagatccggtactcgaccgaccgcggcacgacg
tggtccagcccgcccggcgggctcgtcaccaacgaccgttccggctactccgacctcgcc
gagctgaccggcggcgagatcggtgtgctctacgagggcggtgtggcgttctccgccgac
gagatccgcttcacccggttcacgcccggacaactcggtttgcccggcacgacccacggg
acgccgtcaccgcagccgtccaccccggcgggaccgaccacaccggacagcacgcccgag
gccaacgacgcgtacctgcgcggcaacgcgtccctcaacgacggcctcctgctggacggg
accggcggctacgcggaaatcccgtactcgcgcacgatcgatccgggcgcgggcgatttc
accatcagtacgaggttccgccactccgccacccagaccggcccgaaccaagcgctgttc
tggggctacggcgtcggtgccagtgccgcccaggtgtggctgcgggttcagcccggcagt
gaccagatcgccgcctgggtgcagggacagagcgggcacgcgtacctcacgctggccgac
ccgagcgctgccaccgccttcggtgacgacaaatggcaccagctgaccctcaccagaacc
ggatcacaggtgaccgtgacgatcgatggcgtgtccgccaccggatcgggcgtcgccggc
ccggtgtccacgggcgtgacgggcctgcggctcggtgcgaaaccggacggcacggacgcg
ttcgccgggcggctcgggaacttccagctgtcccggcagggcaagccgagcctggacctc
gcgttcaggaccgtggacggtgccgcggtgcccgcgcgggcgcccgcgccgatcaccgac
gacgtgtccggccactgcgcgaccgcgagcctgctcggcggcaagcagtcaccggtcgac
ggccgtgcgccgaactcggtggcgttgcccgtgaacacggcccatcccggtgtcgagacg
gcgttctcgccgacgctggacctcggttcgggcgatttcacgttcgcggcgtggttccgg
tactccggcgccgcgaaccaggcgatcgtgtgggcgtacggcaccacggcgggcaagcgt
tcggtctgggtgcgtgcccaacccggccaggaccggctccacgcctgggtgcaaacggac
acggcccaggtcgcgatcccgttggtggacacgacaagccgtgtcgcgttcggcgacaac
cagtggcatctgctcgcgttgacccgtaccggcgaccaggtccagctcagtgtcgacggc
ggcacgcccgcgtcggccaccgggctgaccggctcggtgagcggcgaccaggcggacgcc
atcagggggctgcgcctggggtccaagatggacggaacagacgtcgtgcagggcgcgctg
gacgacttccggctctaccgcagggcgctgacagccaccgaactcggccaggcggcgacc
ggcaggtttcccgccgacctgcccgccttgtggtggactttcgaaggccagcacacgcag
gcgcatgacgtcgccgagccgatcaccggtccgcagacctctgacgcctcgacccattgc
gcgcacgccacggtctccggcaacccggccgtggtgcccggcaaggtcggcaacgcggtc
cggttcgacggcgtggacgatgccgtgtacatgccgtacaagccgagtatcgctgtgggg
gacggcgacttcacggtctcgacgtggttgcgttacaccgggaccggtgaccaggtcgtc
ttctgggcgtacggttcgggcgcgacggagcgtggtttgtggatgcgtggccagccgggc
aaggaccggctgctcgtctacctgcagaccgacaccggcgcttacgaagcagcggcggtg
gacgcgtcggcagcggccgggttcaacgacggcgcctggcatttcgtggaagtctcgcgc
cacgccgggacgctcaccctgagtgtggacggcaaccggttgggcagcacggcggtgagc
ggttcggcgacctacggtgacgcgttcgccgtgcagggcttcaggctcggcgccaagccg
gacggcaccaaccgcctcaccgggacgctggacgagttccagatccgccgtggcgcggcg
ctggcggctcacctgccgctcaacgccgcgtcgtga

DBGET integrated database retrieval system