KEGG   Kibdelosporangium phytohabitans: AOZ06_26455
Entry
AOZ06_26455       CDS       T04088                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
kphy  Kibdelosporangium phytohabitans
Pathway
kphy00997  Biosynthesis of various secondary metabolites - part 3
kphy01100  Metabolic pathways
kphy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kphy00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    AOZ06_26455
Enzymes [BR:kphy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     AOZ06_26455
SSDB
Motif
Pfam: DeoC
Other DBs
NCBI-ProteinID: ALG09969
UniProt: A0A0N9I285
LinkDB
Position
complement(5862314..5863129)
AA seq 271 aa
MSRTPLTGKTLRMARLSRPRDDRYLFVPLDHSMADGPITDEADFNQLVSDISLGGADAIV
VHKGRSRTIEPELLGGCALIVHLSASTDHAVDSDAKVLVSDVEEALRLGADAVSVHVNVG
SDTEAIQLAALGAVASACDQWGVPLLAMIYLRGPRVIHPNSPQQLSHMVSIAADMGADLV
KTVLAAPIERMTEVTAASPLPVVVAGGDGHDMSLFDFATAAMAVGCHGLAVGRRVFTDDT
PRRVVHQLATIVHGEEFTPETALRAHLAGTL
NT seq 816 nt   +upstreamnt  +downstreamnt
atgtccagaacaccactgacaggcaagacgctgcggatggcgcggctgtcgcggccacgc
gacgaccgatatctgttcgtcccgctcgaccactccatggccgacggcccgatcaccgac
gaggccgacttcaaccagctcgtcagcgacatcagcctgggcggggccgacgccatcgtg
gtccacaaaggacgatcacggacgatcgagccggagctgctcggcggctgcgcgctgatc
gtgcacctgtccgccagcaccgaccacgccgtggacagcgacgccaaagtcctcgtcagc
gacgtcgaggaggcgctgcggctcggcgcggacgcggtgagcgtgcacgtcaacgtcggc
tccgacaccgaggccatccagctggcggccctcggcgcggtcgcgtccgcgtgcgaccag
tggggcgtgccactgctggccatgatctacctccgcggtccccgcgtgatccacccgaac
agtccccaacagctctcccacatggtcagcatcgccgccgacatgggcgccgacctcgtc
aagacggtgctggccgcaccgatcgaacggatgaccgaggtcaccgctgcctctcccctc
ccggtcgtcgtggccgggggcgacgggcacgacatgagcctgttcgacttcgccacggcc
gcgatggcggtcggctgccacggcctggccgtgggcaggcgtgtgttcaccgacgacacg
ccgcggcgggtggtccaccagctggccacgatcgtgcacggcgaggagttcacccccgag
acagcgctacgagcccacctggcaggtacattgtga

DBGET integrated database retrieval system