KEGG   Kibdelosporangium phytohabitans: AOZ06_28635Help
Entry
AOZ06_28635       CDS       T04088                                 

Definition
(GenBank) hypothetical protein
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
kphy  Kibdelosporangium phytohabitans
Brite
KEGG Orthology (KO) [BR:kphy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:kphy01002]
    AOZ06_28635
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kphy04147]
    AOZ06_28635
Enzymes [BR:kphy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     AOZ06_28635
Peptidases [BR:kphy01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   AOZ06_28635
Exosome [BR:kphy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AOZ06_28635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-ProteinID: ALG10333
UniProt: A0A0N9I757
LinkDB All DBs
Position
complement(6314549..6315313)
Genome map
AA seq 254 aa AA seqDB search
MRRSLFATVALLLAVAHAAPASAEERIIGGEAAFINDFPFMLSLQEEGVHVCGAVIVSEK
YALTTAHCTRKVAVEDLSVRVGSTKHGTGGAKVEIATVAAHPLFDRRTADFDIAALRFKT
DLPHNVNVAEVEVAYLPPAAGDELMVAGWGDTERGGELAARLRTTTIPKVDWDECAGKIR
ITARIMCAGPSDGSKGICLGDSGGPGIKGGRLVGVISWSLAKCMDPHLESAGYTGFVDVT
NKAVRDWIKAVTKV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgttccctgttcgctaccgtcgccctcctgttggccgtggcccacgccgctccc
gcgtccgccgaggagcgcatcatcggcggcgaggcggcgttcatcaacgacttccccttc
atgctgagcctccaggaggagggtgtgcacgtctgcggcgctgtgatcgtgtcagagaag
tacgcgctcaccaccgcgcactgcacccgcaaggtggccgtcgaggacctgagcgtccgg
gtcggcagcacgaagcacggcaccggcggcgccaaggtcgagatcgccacggtggccgcg
catcccctcttcgaccgtcgcacggccgacttcgacatcgcggcgctgcggttcaagaca
gacctgccgcacaacgtcaacgtcgccgaggtggaggtcgcgtacctgccgccggcggcg
ggcgacgaactcatggtggccgggtggggggacacggaacgcggcggagaactggccgcg
aggctgcgcaccacgaccattccgaaggtggactgggacgagtgcgccggcaagatcagg
atcacggccaggataatgtgcgcgggtccctcggatggcagcaaaggcatatgtctcggc
gactccggagggccgggaatcaaaggggggcgcctcgtcggcgtgatctcctggtccctc
gcgaagtgcatggacccacacttggagtctgccggctacacggggttcgtcgatgtgacg
aataaagccgtgcgcgattggatcaaggccgtgaccaaggtctag

DBGET integrated database retrieval system