KEGG   Kibdelosporangium phytohabitans: AOZ06_32115Help
Entry
AOZ06_32115       CDS       T04088                                 

Definition
(GenBank) beta-ACP synthase
  KO
K05551  minimal PKS ketosynthase (KS/KS alpha) [EC:2.3.1.- 2.3.1.260 2.3.1.235]
Organism
kphy  Kibdelosporangium phytohabitans
Pathway
kphy01056  Biosynthesis of type II polyketide backbone
kphy01100  Metabolic pathways
kphy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kphy00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    AOZ06_32115
   00253 Tetracycline biosynthesis
    AOZ06_32115
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:kphy01004]
    AOZ06_32115
   01008 Polyketide biosynthesis proteins [BR:kphy01008]
    AOZ06_32115
Enzymes [BR:kphy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.235  tetracenomycin F2 synthase
     AOZ06_32115
    2.3.1.260  tetracycline polyketide synthase
     AOZ06_32115
    2.3.1.-  
     AOZ06_32115
Lipid biosynthesis proteins [BR:kphy01004]
 Polyketide synthase
  Component type
   AOZ06_32115
Polyketide biosynthesis proteins [BR:kphy01008]
 Polyketide synthase (PKS)
  Type II PKS
   C7-C12 cyclized polyketide type
    Octaketide PKS
     AOZ06_32115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N
Motif
Other DBs
NCBI-ProteinID: ALG10916
UniProt: A0A0N9I8S8
LinkDB All DBs
Position
complement(7134860..7136113)
Genome map
AA seq 417 aa AA seqDB search
MTRSVVITGIGVVAPGAVGREQFWQLLVDGRTATRTISLFDAEGFRSRIAAEVDFDPAAA
GLTAREVRRMDRAAQFGVVAAREAVRDSGFGFDDVSPERIGVSVGSAVGCTMGLEEEYTV
LSDNGKHWLVDHSYGVPHLYGYMVPSTLAVEVAWEVAAEGPVTLISTGCTSGLDAVNHGA
QLIREGSADVVLAGATDAPLSPITSACFDAIKATSPNNSDAEHASRPFDAKRDGFVLGEG
SAVLVLEEESAARARGARIYGKLAGFASRSNAFHMTGLRPDGREMAEAIRVALDKAQLDR
HDIDYINAHGSGTKQNDRHETAAFKRSLGHHAYKVPVSSIKSMVGHSLGAIGSIELAACA
LTLDRQVVPPTANLHTADPECDLDYVPLTAREHRTNAVLSVGSGFGGFQSAAVLTKV
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggtctgtcgtgatcaccgggatcggcgtcgtcgctcccggtgccgtcggccgc
gagcagttctggcaactgctcgtggacggccggaccgccacgcggaccatctccctgttc
gacgcggagggcttccggtcccggatcgccgccgaagtggacttcgacccggccgccgcc
gggctgaccgcgcgtgaggtgcgccggatggaccgcgcggcgcagttcggtgtcgtggcc
gcgcgggaagccgtgcgcgacagcggattcggtttcgacgacgtcagcccggaacggatc
ggtgtgagcgtcggcagcgcggtcggctgcacgatgggcctcgaagaggagtacaccgtc
ctgtcggacaacgggaaacactggctggtcgatcactcctacggcgtgccgcacctgtac
ggctacatggtgccgagcaccctggccgtcgaggtcgcgtgggaggtggccgcggaaggg
ccggtcacgttgatctccaccgggtgcacgtccggtctggacgcggtcaaccacggcgcg
cagctgatccgggagggctcggccgacgtcgtgctcgccggggcgaccgacgccccgctg
tcgccgatcacgtccgcctgcttcgacgccatcaaggcgacgtcgccgaacaactccgac
gccgagcacgcgtcccgcccgttcgacgcgaagcgggacgggttcgtgctcggcgaaggc
tcggcggtgctcgtcctggaggaggagtcggcggcacgggcccgtggtgcgcggatctac
ggcaagctggccggtttcgccagtcgcagcaacgcgttccacatgaccgggctgcggccg
gacggcagggagatggccgaggcgatccgggtcgcgctggacaaggcgcagctggaccgg
cacgacatcgactacatcaacgcgcacggctccgggaccaagcagaacgaccggcacgag
acggcggcgttcaaacgcagtctcggccaccacgcgtacaaggtcccggtcagttcgatc
aagtccatggtcggccattccctcggcgccatcggctcgatcgaactggcggcgtgcgcg
ctcacgctggaccgccaggtcgtcccgccgacggcgaacctgcacaccgccgaccccgaa
tgcgacctcgactacgtgccgctcaccgcgcgcgagcaccggacgaacgcggtgctgagt
gtcgggagcggattcggcggcttccagagcgcggccgtgctgaccaaggtctag

DBGET integrated database retrieval system