KEGG   Kibdelosporangium phytohabitans: AOZ06_32395Help
Entry
AOZ06_32395       CDS       T04088                                 

Definition
(GenBank) peptidase S8/S53 subtilisin kexin sedolisin
Organism
kphy  Kibdelosporangium phytohabitans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S8 P_proprotein He_PIG Inhibitor_I9 PPC
Motif
Other DBs
NCBI-ProteinID: ALG10964
UniProt: A0A0N9I8I4
LinkDB All DBs
Position
complement(7205497..7207305)
Genome map
AA seq 602 aa AA seqDB search
MRLRSLQGRILGAGIAAAAVFAAVLPTNAAAAQQIIAENAPNKIQDSYVVVLKDNIAVRA
AADGLAARYGGKVGFVYQAALKGFSVAMSAAQARKLAADPAVSYVEQDRTVGLLTDQNNP
PSWGLDRVDQADLPLNQKYSYSTEASNVTAYVIDTGINYNHTDFGGRATFGFDAFNDGQQ
GKDCQGHGTHVAGTIGGNTFGLAKKVKLKAVRVLNCQGGGSISTEAAGVDWVTANAVLPA
VANMSLYTGVKNEPSRVLDDAVRASIGKGISYAVAAGNFNDDSCQYSPQRVRETINVAAT
ARTDARASFSSYGTCSDIFAPGQDIVSASYSNNSGSATMSGTSMASPHVAGAVALYLADN
PAKTPAEVHSAITAAATPNKVTNPGANTPNKLLRVNGGVPGVSVANPGPQNTAVGGAANL
QLSASGGTAPYTWSATGLPPGLSIGSSNGLITGTATTAGTYDVTATATATAGGSGSTNFQ
WTVGSTPTCTPQTNGTDVAIPDLTTVTSSVTFAGCTGNASASSTAEVHIKHTYRGDLQID
LVAPDGSAYRLKNSSTSDSADNVDQTYTVNVSGEARNGTWKLQVRDVARQDVGTIDTWTL
TV
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctcagatccctgcaaggaagaattctcggggcgggtatcgccgccgccgctgtg
ttcgccgctgtcctgccgacgaacgcggccgcggcgcagcagatcatcgccgagaacgcg
cccaacaagatccaggacagctatgtcgtggtgctgaaggacaacatcgcggtccgcgcg
gcggccgacgggctggcggcgcgctacggcggcaaggtcggattcgtgtaccaggccgcg
ctcaagggattctcggtcgccatgtccgccgcgcaggcgcgcaagctcgccgccgacccg
gctgtgtcctatgtggagcaagaccgcacggtcgggctgctgaccgaccagaacaacccg
ccttcgtgggggctcgaccgcgtcgaccaggcggacctgccgctcaaccagaagtacagc
tactccaccgaggcgtcgaacgtcaccgcgtacgtcatcgacaccgggatcaactacaac
cacaccgacttcggcggccgggcgacgttcgggttcgacgcgttcaacgacggccagcag
ggcaaggactgccagggtcacggcacgcacgtcgcgggcaccatcggcggcaacaccttc
ggtctggccaagaaggtcaagctgaaggccgtccgcgtgctcaactgccagggtggcggg
tcgatctccaccgaggccgccggcgtggactgggtgaccgccaacgcggtcctgcccgcc
gtggccaacatgagcctctacaccggtgtcaagaacgagccgagccgtgtgctggacgac
gctgtgcgcgcgtcgatcggcaagggcatctcgtacgccgtggccgcgggcaacttcaac
gacgactcgtgccagtactcgccgcagcgggtccgtgagacgatcaacgtcgccgcgacc
gcgcggaccgacgcccgcgcgtcgttctccagctacggcacctgcagcgacatcttcgcg
cccggccaggacatcgtctcggcgtcgtacagcaacaactccgggtccgcgacgatgagc
ggtacctcgatggcctcgccgcacgtggccggcgccgtcgcgctgtacctggcggacaac
ccggccaagaccccggccgaggtgcacagcgcgatcaccgccgcggcgaccccgaacaag
gtcaccaaccccggcgccaacaccccgaacaagctgctgcgtgtcaacggcggcgtcccg
ggcgtgtccgtggccaacccgggcccgcagaacaccgcggtcggtggggcggcgaacctg
cagctgtcggcgtccggcggcaccgcgccgtacacgtggtccgcgaccggcctgcctccc
ggtctctcgatcggatcgtccaacggtctgatcaccggcacggcgaccaccgcgggcacg
tacgacgtgacggcgaccgccaccgcgaccgcgggtggttccggctcgacgaacttccag
tggacggtcggctcgacgccgacgtgcaccccgcagaccaacggcaccgacgtggccatc
cccgacctgacgacggtgacgagctcggtgacgttcgccgggtgcaccggcaacgcgtcg
gcgtccagcaccgccgaggtgcacatcaagcacacctaccgcggcgacctgcagatcgac
ctggtcgccccggacggctcggcgtaccggttgaagaactccagcacctccgacagcgcg
gacaacgtcgaccagacctacacggtcaacgtgtccggtgaggcgcgcaacggcacctgg
aagctccaggtgcgcgacgtggcccgccaggacgtgggcacgatcgacacctggacgctg
accgtctga

DBGET integrated database retrieval system