KEGG   Kibdelosporangium phytohabitans: AOZ06_32420Help
Entry
AOZ06_32420       CDS       T04088                                 

Definition
(GenBank) hypothetical protein
Organism
kphy  Kibdelosporangium phytohabitans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Reprolysin_5
Motif
Other DBs
NCBI-ProteinID: ALG10967
UniProt: A0A0N7F4B5
LinkDB All DBs
Position
complement(7211385..7211669)
Genome map
AA seq 94 aa AA seqDB search
MHNARLRHAMEAHFSRCQEKPQWKVWLLHAMRHEPTTPTSTLLGIMFDQKGPQRQGCATF
YERIATNPRTQLYTHVHELGHCFNPFHSCHSCRS
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
gtgcacaacgccaggctgcgccacgcgatggaggcgcacttctcgcggtgccaggagaaa
ccgcagtggaaggtgtggttgctgcacgccatgcggcacgagccgaccacgccgacctcc
acgctgctcggcatcatgttcgaccagaaaggcccgcagcggcagggctgcgcgacgttc
tacgaacggatcgcgaccaacccccgcacccagctctacacgcacgtgcacgagctcggg
cactgcttcaacccgttccactcgtgccactcgtgccgttcatga

DBGET integrated database retrieval system