KEGG   Kibdelosporangium phytohabitans: AOZ06_32470Help
Entry
AOZ06_32470       CDS       T04088                                 

Definition
(GenBank) Fe3+-citrate ABC transporter substrate-binding protein
  KO
K23227  ferric hydroxamate transport system substrate-binding protein
Organism
kphy  Kibdelosporangium phytohabitans
Pathway
kphy02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:kphy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AOZ06_32470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kphy02000]
    AOZ06_32470
Transporters [BR:kphy02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Ferric hydroxamate transporter
    AOZ06_32470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_2 Thioredoxin_2
Motif
Other DBs
NCBI-ProteinID: ALG10976
UniProt: A0A0N9I8J2
LinkDB All DBs
Position
7220699..7221661
Genome map
AA seq 320 aa AA seqDB search
MVRALVAACVLALLAGCGTGTVGGNTGAQNSGAQNSGGPITVETARGQVSLAKPATKVVV
LEWAYTEELVSLGVTPVGNADNDGYKKWVTAPGSALPGGVADLGQRQEPSLERIKTLAPD
LIVGEEKTIAVNYDQLKAIAPVVSFDYPVKPQFETMRKNYEQLAKAVGKQDKGKEVLARL
DAKAAEVKSRIKPDTSYAFAQAYSVNGTPTIRMFTGDTLVVQVLGLTGLRSTWQGQPDSW
GLSTVGVEGLTQVPAGAALLYVAQNDDNPFTGALAGNPVWQNLGFVKQKKLYPLDPGTWT
FGGPLSAVQLLDGVGKALAP
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggttcgcgcgctcgttgccgcgtgtgtcctcgcgctactcgcgggttgtggcactggc
acagtcggaggcaacaccggagcccagaactcgggggcacagaactccggtggcccgatc
acggtcgagaccgcacgtggccaggtcagcctcgccaagcccgcgaccaaggtcgtcgtc
ctggaatgggcgtacaccgaggaactggtctcgctgggcgtgaccccggtcggcaacgcc
gacaacgacggctacaagaagtgggtcaccgcacccggttccgcgctgcccggcggcgtg
gccgacctgggccagcgccaggaacccagcctcgaacggatcaagacgctggcgccggac
ctgatcgtcggcgaggagaagaccatcgcggtcaactacgaccagttgaaggcgatcgcg
ccggtggtgtcgttcgactacccggtcaagccgcagttcgagacgatgaggaagaactac
gagcagctggccaaggcggtcggcaagcaggacaagggcaaggaggtcctcgcgcggctc
gacgccaaggcagccgaggtcaagagcaggatcaagccggacacgtcgtacgcgttcgcg
caggcgtacagcgtcaacggcacgccgacgatccggatgttcaccggtgacacgctcgtg
gtccaggtactcgggctcaccgggctgcgcagcacctggcagggccagccggacagctgg
ggactgagcacggtcggtgtcgaaggcctgacgcaggtcccggccggcgcggcactgctc
tacgtggcgcagaacgacgacaacccgttcaccggcgcgctggcgggcaacccggtgtgg
cagaacctgggcttcgtcaagcagaagaagctgtacccgctcgaccccggcacgtggacc
ttcggcggaccgctgtcggccgtgcaactgctcgacggcgtgggcaaggccctggccccc
tga

DBGET integrated database retrieval system