KEGG   Kibdelosporangium phytohabitans: AOZ06_32500Help
Entry
AOZ06_32500       CDS       T04088                                 

Definition
(GenBank) hypothetical protein
Organism
kphy  Kibdelosporangium phytohabitans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2625
Motif
Other DBs
NCBI-ProteinID: ALG10982
UniProt: A0A0N9I5P7
LinkDB All DBs
Position
7225997..7226569
Genome map
AA seq 190 aa AA seqDB search
MNTSAWDEITAAIASAPYPVTVVPADPRRAEDCLGRLGITTNSWLGAVVRHSGGLLVDHG
WLRVLGSGTHLMPEAGRAAGGVAVGHDVLGGRFVWIPTGNGPTVHYYAPDTLEWEDLEVG
YADWLDNMLAGSLTAFYADLRWPGWADEVAAIQPDKGIHTWPPPSTVEGKDLAKVSRTVV
PMTELIGVPE
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacttccgcgtgggacgagatcaccgcggcgatcgcctcggctccctatccggtg
acggtcgtaccagccgatccgcggcgtgccgaggactgcctcgggcgcctcggcatcacg
acgaactcgtggctgggcgcggtggtcaggcactccggtggcctgctcgtcgaccacggc
tggctgcgcgtgctcggttcgggcacgcacctgatgccggaggccggccgggccgctggt
ggtgtggccgtcggtcacgacgtgctcggcggccggttcgtgtggatccccaccgggaac
ggtccgacggtccactactacgcgccggacacgctcgagtgggaggacctcgaggtcggg
tacgcggactggctcgacaacatgctggccgggtcgctcaccgcgttctacgcggacctg
cgctggccgggctgggccgacgaggtcgccgcgatccaaccggacaagggcatccacacc
tggccgccgccgtcgaccgtggagggcaaggacctggccaaggtgtccaggacagtcgtc
ccgatgaccgagctgatcggcgtgcccgagtag

DBGET integrated database retrieval system