KEGG   Kibdelosporangium phytohabitans: AOZ06_32530Help
Entry
AOZ06_32530       CDS       T04088                                 

Definition
(GenBank) hypothetical protein
  KO
K08167  MFS transporter, DHA2 family, multidrug resistance protein
Organism
kphy  Kibdelosporangium phytohabitans
Brite
KEGG Orthology (KO) [BR:kphy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kphy02000]
    AOZ06_32530
   01504 Antimicrobial resistance genes [BR:kphy01504]
    AOZ06_32530
Transporters [BR:kphy02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-2 (14 spanner) (DHA2) family [TC:2.A.1.3]
    AOZ06_32530
Antimicrobial resistance genes [BR:kphy01504]
 Gene variants
  Quinolone resistance genes
   Transporter
    AOZ06_32530
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump QacA [MD:M00714]
    AOZ06_32530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr OATP
Motif
Other DBs
NCBI-ProteinID: ALG10988
UniProt: A0A0N9HUL9
LinkDB All DBs
Position
7232529..7233881
Genome map
AA seq 450 aa AA seqDB search
MCSGLLLVAMDNTILNVALPAIATALRPGATGLLWIVDLYSLVVAGLLVTAGTASDRLGR
KRFFLAGMVLFGVASVVAAFAGSTEALLASRVLRGIGGAMIMPATLSIIRAVFADERERA
FAIGIWTSTAAAGAAIGPIVAGAMLERFWWGSVFLTSLPIIVLAVALTIVYVPESRDPAP
GRFDPLSVVLSMGAVVGVVYGIKELAGHGSAGAAAVLVAGLVLGVVFVRRQNRLDSPLLD
LSLFRARRFTAATLSVLLSFFGFFGVVFFLTQYFQAFEGFGPLATGLWLLPLALASLVAS
PLTGTIVRRLGTRVALSGSFGLIAVSISLFTMLGGSADRLVIVIGFIGMGVGASIAATAG
AQAIMTSVAPHRAGGAAAIQETSFELGAGLGVAILGSVMAARLGGRTIAEAGKAAFFDGL
ATAAGVSAAVMLVTAVLAALWLPSRDAEHV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtgcagcgggttgctcctcgtggcgatggacaacacgatcctcaacgtcgcactgccc
gcgatcgcgacggcgctgcggccgggcgcgaccggactgctgtggatcgtcgacctctac
tcgctggtcgtggccggtctcctggtcacggcgggtaccgcgagcgaccggttggggcgc
aagcggttcttcctcgcgggcatggtgctgttcggtgtcgcgtcggtggtcgcggcgttc
gcgggctcgacggaagcgctgctcgcgtcacgggtcctgcgtggcatcggcggcgcgatg
atcatgcccgccacgttgtcgatcatccgggcggtgttcgccgacgagcgggaaagggcc
ttcgcgatcggcatctggacgtcgaccgcggcggcgggcgcggcgatcggcccgatcgtg
gcaggcgcgatgctggagcggttctggtggggctcggtgttcctgaccagcttgccgatc
atcgtgctggcagtggcgctgacgatcgtgtacgtgccggagtcgcgtgacccggccccg
ggcaggttcgacccgttgagcgtggtgctgtcgatgggggcggtggtcggcgtggtgtac
ggcatcaaggaactggccggccacggatcggcgggcgcggcggctgtcctggtcgcgggc
ctggtgctgggtgtggtgttcgtgcgcaggcagaaccggctggacagcccgctgctggac
ctgtcgctgttcagggcgaggcggttcaccgcggcgacgctgtcggtgttgttgtcgttc
ttcggtttcttcggtgtggtgttcttcctgacgcagtacttccaggcgttcgagggcttc
gggccgctggccaccgggctgtggctgctgccgttggcgctggccagcctggtcgcgtcg
ccgctgaccggcacgatcgtgcggcggctgggcacgagagtcgcgttgtccggctcgttc
ggcctgatcgcggtgtcgatcagcctgttcacgatgctcggcgggagcgccgaccggttg
gtcatcgtcatcgggttcatcggtatgggggtgggggcgagcatcgcggccaccgcgggc
gcgcaggcgatcatgacgagtgtggcgccgcaccgggccggtggcgcggcagcgatccag
gagacgtcgttcgaactcggcgcgggactgggtgtcgcgatcctcggcagtgtgatggcc
gcgcggctgggcggtcgcacgatcgccgaggcgggcaaggccgcgttcttcgacggcctg
gcgacagcggcgggtgtgagcgcggcggtgatgctcgtgacggcggtcctcgccgcgctc
tggctgccgtctcgtgacgccgaacacgtgtag

DBGET integrated database retrieval system