KEGG   Kibdelosporangium phytohabitans: AOZ06_32540Help
Entry
AOZ06_32540       CDS       T04088                                 

Definition
(GenBank) hypothetical protein
  KO
K07114  Ca-activated chloride channel homolog
Organism
kphy  Kibdelosporangium phytohabitans
Brite
KEGG Orthology (KO) [BR:kphy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kphy02000]
    AOZ06_32540
Transporters [BR:kphy02000]
 Other transporters
  Pores ion channels [TC:1]
   AOZ06_32540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_11 VWA_2 VWA_3 CitMHS SBP_bac_8
Motif
Other DBs
NCBI-ProteinID: ALG10989
UniProt: A0A0N9I4I5
LinkDB All DBs
Position
7235100..7236965
Genome map
AA seq 621 aa AA seqDB search
MNGQVPTKGPDRTKVIVVVLIATATIAVGIVTDPPEGVVGWIVFVFGALILAVVGAGLAE
WLAGWIKAFFHGLPYNRIVAVTVVGTLTCGAAYTFVPIIPVIWPGDCGPPTQVRVLTTPD
LLTPYRDLAAAFEQAEAERDGSCRTAEVHVFAMPAPRAMAGLGTGWHADYLREGPRPDIW
LPENGRQVEAVKSRKEMTSFGAAMEVTASLGSSPIVLAVPARAGIEPTDEQWQGQTWRAL
VGKLRAAGIGMVRPGTSTAGELATVAIYGSEDGRVQLRQDPSWARAFEAWVDSTAKSGQY
PSGADVDALLRRQQELGPAGAALVLAEPDLIRYNQSVRRASGRGCDVQNGPPECMRAVYP
SDTYSFDRPLALLSWSEAPQSAAQRDAAVAFRTWLTSAAGANAAVLQRLRPPPGTPLQDP
VSMANGVVPGGPPNHITGPASPGPGVTEQLTGIRDEVRKTGRVVISLDASGSMRQRAGGA
TRYSLAVKAILAAHDKLAKQAQVSLNVFSATMGVRPVDAGSIGQVQPAGNTPQHRAILEG
AQAAGPGGVLVLLTDGNNNVNDVSPRQLADQAGARVLVLAFGEASCGARVLIDVTSTSGG
SCRQAGVDTLQADLTELLRSV
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtcaagttccaacgaagggaccagaccgcaccaaggtgatcgtcgtcgtgctc
atcgccaccgcgacgatagccgtcggaatcgtgaccgacccgccggaaggcgtcgtcggt
tggatcgtcttcgtcttcggggcgctgatcctggccgtggtcggcgccgggctcgccgag
tggctcgccgggtggatcaaggcgttcttccacggcctgccgtacaaccggatcgtcgcg
gtcacggtcgtcggcacgctcacctgcggcgcggcgtacaccttcgttccgatcattccg
gtgatctggcccggcgattgcggtccgccgacccaggtccgcgtgctgaccactcccgat
ctgctgacgccgtaccgcgatctggcggccgcgttcgagcaggccgaagccgaacgcgac
ggttcgtgccgcacagcggaggtccacgtcttcgcgatgcccgcgccgcgggcgatggca
ggcctcggcaccgggtggcacgcggactacctgcgcgaagggccgcggccggacatctgg
ttgcccgagaacgggaggcaggtggaagcggtcaagagccgcaaggagatgaccagtttc
ggcgcggccatggaggtgaccgcgtcactcgggtcgtctccgatcgtgctggcggtgccc
gcccgtgccgggatcgagccgaccgacgagcagtggcagggccagacgtggcgggcactg
gtcggcaagctgcgggcagccggaatcggcatggtgcgaccgggcacgtccaccgcaggc
gaactggcgacggtggcgatctacggcagcgaggacggccgggtccagttgcgccaggac
ccgtcgtgggcgcgggcgttcgaggcgtgggtggacagcacggccaagtcgggccagtac
ccgtcgggcgcggacgtcgacgcgttgctgcgcaggcaacaggagctcggtccggcaggc
gccgcgctcgtgctcgcggagccggacctgatccggtacaaccagtccgtgcgccgcgcc
agcggcaggggctgcgatgtccagaatggaccgccggagtgcatgcgggcggtctacccg
tcggacacgtacagcttcgaccggccgttggccctgctgtcctggtcggaggcgccgcag
agcgccgcgcagcgcgatgccgccgttgccttccggacgtggctgaccagcgcggcaggc
gccaatgcggctgtgctgcaacggcttcggccgccacctggaacgccgctgcaggatccg
gtgtcgatggccaacggtgtcgtgcccggcgggccgccgaaccacatcaccgggccggcc
agtcccgggcctggggtcaccgagcagttgaccgggattcgcgacgaggtccgcaagacc
ggccgcgtggtgatctcgttggacgcgtcgggttcgatgcggcaacgcgccggtggcgcg
acccgctacagcctcgcggtgaaggcgattctcgccgcgcacgacaagctggccaaacag
gctcaggtgtccttgaacgtcttctcggcgacgatgggtgtgcggccggtcgacgccggt
tcgatcggccaggtccaaccggcgggcaacaccccgcagcaccgggcgattctcgagggc
gcccaggccgcgggacctggcggtgtgctggtcctgctgaccgacggcaacaacaacgtc
aacgacgtgtccccgcggcaactggccgaccaggctggtgcgcgggtgctggtgctggcg
ttcggggaggccagctgcggcgctcgggtgttgatcgacgtgacgagcacgagcggcggt
tcgtgccgccaggcgggcgtggacacgctgcaggcggatctgaccgagctgctgcgttcg
gtgtga

DBGET integrated database retrieval system