KEGG   Kibdelosporangium phytohabitans: AOZ06_32625Help
Entry
AOZ06_32625       CDS       T04088                                 

Definition
(GenBank) hypothetical protein
Organism
kphy  Kibdelosporangium phytohabitans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ALG11001
UniProt: A0A0N9I4J3
LinkDB All DBs
Position
7253239..7253457
Genome map
AA seq 72 aa AA seqDB search
MGLFIAFEVIGIIGMVQGFGSALVTQVWGGNWALMRWALEWQPVAGIAVGVLGLLIASIG
WSGQKRIKSSRR
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgggactgttcatcgccttcgaggtcatcggcatcatcgggatggtgcagggcttcggc
tcggccctggtcacccaggtgtggggcggcaactgggcgctgatgcggtgggcgctggag
tggcagccggtcgcgggtatcgcggtcggtgtgctggggctgctgatcgcttcgatcggc
tggagcggtcagaagcggatcaagtcgtcgcgccgctga

DBGET integrated database retrieval system