KEGG   Kibdelosporangium phytohabitans: AOZ06_32815Help
Entry
AOZ06_32815       CDS       T04088                                 

Definition
(GenBank) hypothetical protein
Organism
kphy  Kibdelosporangium phytohabitans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GyrI-like
Motif
Other DBs
NCBI-ProteinID: ALG11035
UniProt: A0A0N9I4L8
LinkDB All DBs
Position
7292119..7292685
Genome map
AA seq 188 aa AA seqDB search
MNEYKHLFTGTTEPALIDMPSLPYLMVDGKGAPDSPEYSNAVSGLYAVAYAVRAALKPVM
TYSVLPLQGQWWSPDPAVFTTGDRSAWCWTMMILQPAEVTAGLVAEATEKAARRKRVDGV
RFERLTEGTCAQILHKGPYSEEPATIARLMDFVRREGRQLTGKHHEIYLTRPRTDAPEKM
RTLIRYPV
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgagtacaagcacctgttcaccggcacgaccgaacccgcgctgatcgacatgcct
tcgttgccatatctcatggttgacggcaagggcgcgccggattcacccgaatacagcaac
gcggtgtccgggctctacgcggtcgcgtacgccgtgcgggcggcgctgaaacccgtcatg
acgtactccgtgctgcccctgcaaggtcaatggtggtcacccgatccggcagtcttcacc
accggggaccgctcggcctggtgctggaccatgatgatcctgcagcccgccgaggtgacc
gccggcctcgtcgccgaagcgaccgagaaggccgcgcggcgcaagcgagtcgacggtgtg
cggttcgagcggctcacggagggaacgtgcgcgcagatcctgcacaaaggcccgtacagc
gaggaaccggcgacgatcgccaggctgatggacttcgtgcggcgggaaggcaggcagctc
accggcaaacaccatgagatctacctgaccaggccgcgcacggacgctccggagaagatg
cggaccttgatccgctatccggtctga

DBGET integrated database retrieval system