KEGG   Kibdelosporangium phytohabitans: AOZ06_32850Help
Entry
AOZ06_32850       CDS       T04088                                 

Definition
(GenBank) alpha/beta hydrolase
Organism
kphy  Kibdelosporangium phytohabitans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 EHN Ndr Thioesterase
Motif
Other DBs
NCBI-ProteinID: ALG15228
UniProt: A0A0N9I578
LinkDB All DBs
Position
complement(7300662..7301621)
Genome map
AA seq 319 aa AA seqDB search
MTLNRRNLFSIGAAGAVLAATGQPAAAGQNAPSDEALVRSLPGFSHGYARVNGIRMHYVT
GGRGRPLVLVPGWPQTWWEFHKIMPALAARYRVIAVDMRGQGGTDKPAGGYDKKTMARDI
YELVRHLGYKQVDIVGHDIGAMTAFSFAANHPAATRTVSLLDVGHPDESLFHIPLLAPPG
VPVHVWWFAFNQVRSLPEQLLHGRFRYMVDWLFDTLLYDKASVGGRDRAIYAAAWDRPDA
IRAGNAWYQGFYQDIEDQKAYGKITVPMLGLAAEYNDTLAQSLPDKGTDVRLGKIAKSGH
FLPDEQPEAVTKALLEFLR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgactctcaaccgacgcaacctcttctccatcggcgcggcgggtgccgtcctcgccgcc
accggccagcccgcggctgccggccagaacgctccctccgacgaggcgctggttcgttcc
ttacccggcttcagtcacggctacgcgagagtcaacggcatccggatgcactacgtgacc
ggcgggcgaggcagaccgctggtgctcgtgccgggctggccgcagacctggtgggagttc
cacaagatcatgcccgcgctggcggcccggtaccgcgtgatcgcggtggacatgcgcggc
cagggcggaacggacaagcccgccggcggctacgacaagaagacgatggcccgtgacatc
tacgagctggtccggcacctcgggtacaagcaggtggacatcgtcggccacgacatcggc
gcgatgaccgcgttcagcttcgccgccaaccacccggccgcgacgcggacggtgagcctg
ctggacgtcggtcaccccgacgagagcctgttccacatcccgctgctggcgccgcccgga
gtgcccgtgcacgtctggtggttcgcgttcaaccaggtgcgctccctgccggagcagctg
ctccacggccggttccgctacatggtcgactggttgttcgacacgctgctgtacgacaag
gcctcggtcggtggacgcgaccgcgcgatctacgcggcggcgtgggaccggccggacgcc
atccgcgcgggcaacgcctggtaccagggcttctaccaggacatcgaggaccagaaggcg
tacggcaagatcaccgtgccgatgctgggcctggccgccgagtacaacgacacgctggcg
cagtcgttgccggacaagggaaccgacgtgcggctcggcaagatcgcgaagtcagggcac
ttcctgccggacgagcagccggaggcggtgacgaaggcgctgctcgagttcctacgctga

DBGET integrated database retrieval system