KEGG   Kibdelosporangium phytohabitans: AOZ06_32935Help
Entry
AOZ06_32935       CDS       T04088                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
kphy  Kibdelosporangium phytohabitans
Pathway
kphy00071  Fatty acid degradation
kphy00280  Valine, leucine and isoleucine degradation
kphy00281  Geraniol degradation
kphy00310  Lysine degradation
kphy00360  Phenylalanine metabolism
kphy00362  Benzoate degradation
kphy00380  Tryptophan metabolism
kphy00410  beta-Alanine metabolism
kphy00627  Aminobenzoate degradation
kphy00640  Propanoate metabolism
kphy00650  Butanoate metabolism
kphy00903  Limonene and pinene degradation
kphy00930  Caprolactam degradation
kphy01100  Metabolic pathways
kphy01110  Biosynthesis of secondary metabolites
kphy01120  Microbial metabolism in diverse environments
kphy01212  Fatty acid metabolism
Module
kphy_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kphy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AOZ06_32935
   00650 Butanoate metabolism
    AOZ06_32935
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AOZ06_32935
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AOZ06_32935
   00310 Lysine degradation
    AOZ06_32935
   00360 Phenylalanine metabolism
    AOZ06_32935
   00380 Tryptophan metabolism
    AOZ06_32935
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AOZ06_32935
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AOZ06_32935
   00281 Geraniol degradation
    AOZ06_32935
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AOZ06_32935
   00627 Aminobenzoate degradation
    AOZ06_32935
   00930 Caprolactam degradation
    AOZ06_32935
Enzymes [BR:kphy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AOZ06_32935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ALG11054
UniProt: A0A0N9I584
LinkDB All DBs
Position
complement(7319161..7319985)
Genome map
AA seq 274 aa AA seqDB search
MADNLVSLQVKQSGHVAEVTLLGPGKGNAMGPDFWRELPVVFRELDADPDIRAIVLTGSG
KHFSYGLDLPAMMTEWGGMLGGTALAGARTEFLAKIRTMQDSVTAVADCRKPVIAAVSGW
CVGGGVDLIAAADIRLASADAKFSVREVRVAMVADIGSLQRLGGIVGEGHLRELAYTGKD
VDAARAEKIGLVNDVYADQDALLAAAHELAASIAKNPPLVVQGVKDVLDHQRAPRVADGL
RYVSTWNAAFLPSKDLGEAVQAFLERRDPEFSGE
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaacctcgtatcgctccaggtgaagcagtccggtcacgtcgccgaggtgacg
ctgctcggaccgggcaagggcaacgcgatgggcccggacttctggcgcgaactgccggtc
gtgttccgcgagctcgacgccgacccggacatccgcgcgatcgtgctcaccggcagcggc
aagcacttctcctacggcctcgacctgcccgcgatgatgaccgagtggggcgggatgctc
ggcggcaccgcgctggccggtgcgcgcaccgagttcctcgccaagatccgcaccatgcag
gactcggtcaccgccgtcgcggactgccgcaagccggtgatcgccgcggtctccggctgg
tgcgtcggcggtggtgtcgacctgatcgcggccgccgacatccggctggcgtcggcggac
gcgaagttcagcgtccgcgaggtgcgggtcgcgatggtcgcggacatcggcagcctgcag
cggctcggcgggatcgtcggcgagggccacctgcgcgagctcgcgtacaccggcaaggac
gtcgacgcggcccgcgccgagaagatcggcctggtcaacgacgtgtacgcggaccaggac
gcgctgctggccgccgcgcacgagctggccgcgtcgatcgccaagaacccgccgctcgtg
gtgcagggcgtcaaggacgtgctcgaccaccagcgcgcgccccgcgtggccgacggcctt
cgctacgtctcgacgtggaacgcggcgttcctgccgagcaaggacctgggtgaagcggta
caggcgttcctcgagcgtcgcgatccggagttctccggtgaataa

DBGET integrated database retrieval system