KEGG   Kibdelosporangium phytohabitans: AOZ06_39640Help
Entry
AOZ06_39640       CDS       T04088                                 

Definition
(GenBank) hypothetical protein
Organism
kphy  Kibdelosporangium phytohabitans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt KR Acyl_transf_1 PS-DH Ketoacyl-synt_C KAsynt_C_assoc PP-binding adh_short Thiolase_N Epimerase GDP_Man_Dehyd Polysacc_synt_2 Docking ACP_syn_III 3Beta_HSD NmrA
Motif
Other DBs
NCBI-ProteinID: ALG12163
UniProt: A0A0N9I7M2
LinkDB All DBs
Position
complement(8867521..8887944)
Genome map
AA seq 6807 aa AA seqDB search
MSDEGRLFEYLKRVTADLRQARGELAGHREPIAIVGMACRFPGGVTTPEQLWDLVSAGGD
AMGEMPDDRGWDLAGLYHPDPEHTGTTYTRAGGFLPDPGGFDAEFFGITPREAMATDPQQ
RILLEVTWEALERAGIPADSRRGSRVGVFVGTSGQDYATLPSSPQVEGYLAAGNAASLMS
GRIAYSFGFNGPAATVDTACSSSLVAMHLAAQALRNGECSLAVAGGVTLMTSPNLLVEFA
RQRGLSPDGRCKAFAAAADGTGFADGVGVLLLARLSDAEREGLPVLAVIRGSAVNSDGAS
NGLTAPNGRAQEQVIRQALANAGLSLSDVDAVEAHGTGTTLGDPIEAEALLATYGQGRDE
PLWLGSVKSNIGHTQAAAGVAGVIKMVMAFRNGLLPRTLHVDSPTPHVDWTSGQVRLLTE
NQPWPEAGRPRRAAVSSFGVSGTNAHLILEQAVTRVQAAAPADRVVPLLLSARTEPALRD
QARRLLTALRDDMSVVDIGHTLATGRSALEYRAQVVAGDVDDLRAVLAAVADGGGQVGVV
DNPGRVAFVFSGQGAQRLDMGTVLYQAFPVFADAFDEVCSRLDPGLREVVRSDRHRLDRT
EFAQQALFAFEVALARLFESIGVRPSVVAGHSVGEVAAAHVAGVLDLDDACALVAARSRL
MQECRQDGVMAAVQASEEEIHEHLSGEVALAAVNAPQAVVISGDADAVRRVADHWASLGR
KTTELRVSHAFHSHHMDQALPGFRQALAGLTFRSPSIAMVPTSNGDVTTAEYWVAQLRSP
VRFEHAVRTMAERGTSVFLEVGPGAPLTALGGHFDSGAAFIAAQRDKGEEANNLASALAQ
LHVAGVRWEWDAAFPGGRKIQLPTYAFQHEHYWMPPTSGAGDVETAGLLTAGHPLLSAVT
DLGDDGCVLTGRVSLSTHSWLAEHRILGTVVVPGTALVEMAVSAGRRFGCAHLAELTSRT
PLTLPETEAVVVQVRVGAGGDSRPVSISSRAVDSAEWTLHAEGVLTEDSAVGDESYPTAW
PPAGTSPVDVTTVYDRLSDDGYGYGSVFRGLRAAWRRGDELFAEVAVPEDTDVAGFDVHP
ALLDAALHVMLVDAREGQVWLPFSWSGVSVWPGTPRRLRVRVSPVTRDTVSVLVTDTAGE
PVAAVRRLTGRAASARDIQPARVNVRDWLLRPDWLPVRTPQGAARFTWLGPDADLASITA
PGDVAVVVGADGDAMTAGYAGVHRVLTLVRQWLRDERFASARLVVVVRPADWAAAGVWGL
VRSAQTEHPGRFVLVESDATGEALLPAALAGGEPQLAIREGRVLVPRLVRAQAGGEPVAL
NPGGTVLITGGTGVLGGLLARHLVAEHGVRHLVLAGRSGRADVADLDADVRVVACDVSDR
DDVRLLLDGIPAEHPLTAVIHAAGVLDDGVVETMTSQRIVDVFGPKVGGAWHLHELTEEL
DLEAFVVFSSAAGLLGSGGQANYAAANTFLDAIAVHRRSQGLAAHSLAWGMWEPNGGMTG
GLDATSRARFARGGIAPFTATDGLALFDLALSTDDAVLAPARFDLTNVPDPAPAVLRELV
RRSTSNPVPNPGSRSPRDRMARLSPPERQDAVLALVRDQVAVVVGYPDGAAVDADRPFKD
LGFDSLMSVELRNGLVSLTGVRLSATAVFDYPTPRGLAVHLHAALFGADEKLPRQVTAVV
QDDDPIVIVGMACRYPGGITSPEDLWDLVAAGTDAVSEFPADRGWDPGLYDPEPGRTGHS
YTRHGGFLHDAADFDAEFFGISPREALAMDPQQRLLLEVSWEVVERAGIDPVSLRGSRTG
VFVGVMYHDYGTRIGAVADDVEGYVGTGTSGSVASGRVAYTLGLEGPAVTVDTACSSSLV
ALHLAAQALRSGECDLALAGGVTVMATPTTFVDFSRQRGLAPDGRCKSFAAGADGTGWSE
GAGLLLVQRLSDARRDGRRVLGVVRGSAVNQDGASNGLTAPNGPSQQRVIRAALAGAGLG
VSDVDVVEAHGTGTRLGDPIEAQALLATYGQGRVRPLLLGSIKSNLGHTQAAAGVAGVIK
MVMAMRHGVLPRSLHVDEPTPHVDWTAGSVELLTERVVWPEVDRPRRAGVSSFGISGTNA
HIIIEQVPTGEEPTDNTPATPLPWVLSAKSDRALRVQAERLRTWASRSPGSSVADIGYSL
ATGRAALNHRAVVVGTDRSDFLRGLETIATGTSPGDRIAEGIAGSGKLALLFPGQGSQVV
GMGRGLAESFPVFGSVFGEVCGLVDAELGGSLAEVLWGGDGGVVDRTVFAQVGLFAVEVS
LFRLLESWGVRPDYLVGHSVGEVAAACVSGVLSLGDAVRLVVARGRLMQGLPGGGAMVSV
AAPVAEVVARVEGVSGVGVAAVNGPRQVVVSGVESVVLGVVEGFAAEGVRTRRLRVSHAF
HSSLMEPMLVEFERVVGGLSFGEPRIPVVSTVGAGLDMSTPQYWVRQVREPVLFADAVAR
VAEQGVTRFVEAGPGSALSTMVESCLADLEEGAAVALLRRNQPESQSVIDGIARLYVNGV
PLSLAPVFGRARTVDLPTYAFHRKRYWPTGDAVATGSAGSGHPLLSAAVVLADSGGALLT
GKLSLASHQWLVDHAVRGVSLFPGTGFVELAAHAGGCVDYPVVDELTIQAPLAMPEQGAV
ELQISVGEEKSGQREVRVYSRIAGASADQSWTCHASGTLVPARPATRRDDVTSWPPSGAR
AVDVDGLYEDLAAAGLDYGPAFHGVQRVWRRDHELFAELALPDGDLVGGSRFGLHPALFD
AALHVARLSDRAWDGTGSKLPFSWSGFELNKAGATELRLKLTSTDSGALSLAMNDIDGSP
VASVESVVLRPVTAEQLAAAQTGHSEPMHRSEWVAVTTPAGAVQSWAWWGLESLANANAD
VIVLPFLTGSDHDDTVDRVHATTTAALDAVQQWLSDVRFGSSKLVVLTQNAVSAGGSSRP
VDLAGAAVWGLIRSAQLEHPGRIVLVDVDEPDEAAAALASALRTGENQVAIRGDSVLGHR
LVPVVRTTVDEVPAWRGTVLVTGGTGGLGALIARHLVTVHGVERLVLVSRRGTDAPGAAE
LVDELTALGAHVDVAACDTSDRAALAQVLATIPADHPLGGIVHTAGVLDDGVLTALSPER
LALVLRPKVDAAWHLHELTKDSDLGAFVLFSSAAGVIGAAGQANYAAANAFLDALAVHRR
EQDLPGQSLAWGLWANTDGGMATRMSEADTERLTRAGVTALSAPEGLALFDAAGRNGHPV
LVPMRLAPAKRARETAPAGGTTFRRQLSGMDASARLRTVQDLVLAQTAAVLGHASAAEIH
PGRAFQGLGFDSLTAVELRNGLSTATRLRLPATLVFDHPNPAALAEYLVSELVGEPAESE
VGEAPQVLDDDPIVIVGMACRYPGGITSPEDLWRLVSTDGDAISEFPADRGWDGDGLYDP
DASRYGKSATRHGGFLHDAADFDAGFFGISPREALAMDPQQRLLLEVSWEVVERAGIDPV
SLRGSRTGVFAGVMYHDYGARMADVDDAEGYVGTGNSGSIASGRVAYALGFEGPAVTVDT
ACSSSLVALHLAAQALRTGECDLALAGGVTVMATPAAFVGFSRQGGLSPDGRCKSFAAGA
DGTGWSEGVGLLLVQRLSDARRDGRRVLGVVRGSAVNQDGASNGLTAPNGPSQQRVIRAA
LRNSGLSAVDVDAVEAHGTGTKLGDPIEAQALLATYGQGRVRPLLLGSIKSNLGHTQAAA
GVAGVIKMVMAMRHGVLPRSLHVDEPTPHVDWTAGSVELLTERVVWPEVDRPRRAGVSSF
GISGTNAHVIIEQPSEPTAESSAADPDLVVWSVSARSPEALRAQANRLLSHVDAHPETAA
GEVGRSLATARAHLEFRASVIGADREELRHGLAAVAAGELVDGIFAGREQTGSTGFLFPG
QGSQVVGMGRGLAESFPVFGSVFGEVCGLVDAELGGSLAEVLWGGDGGVVDRTVFAQVGL
FAVEVSLFRLLESWGVRPDYLVGHSVGEVAAACVSGVLSLGDAVRLVVARGRLMQGLPGG
GAMVSVAAPVAEVVARVEGVSGVGVAAVNGPRQVVVSGVESVVLGVVEGFAAEGVRTRRL
RVSHAFHSSLMEPMLVEFERVVGGLSFGAPRIPVVSTVGAGLDMSTPQYWVRQVREPVLF
ADAVNHLAAEGVRRFVEIGPGTALTVLAKENLVDSQAVVLPTLRRGEDEPRQVVEAIAGL
HVSGASLEWARFFAGVNQVDLPTYAFQHRRYWYDVPVGQPGDIRNVGQQAVTHPLLGAAV
ALPATGGMAFTGRLSVATQLWLADHLVAGIVLFPATGFVELARHAGDELGCPVVEELSIQ
APLVMPANAAVSVQVSVGQVGDDGRRTVSVYSRPEDTAADQRWTCHATGELASPIAIPLQ
QDSSAWPPVGALAVDPDALYDKLAARGLDYGPVFRGVRAAWQRGEELFAEVDLPEDEHPA
ATRYGLHPALFDAALHVAAVNGEAAALPFAWTGVTLHAAGATALRVSVVTSGENTMAIHL
ATQDGIPVADVGSLVSRPISPEQLAAARTDHDDLLFRRNWVPITPPQPTAEPETWSWYAQ
DGPVADVLVIAFTAGGASDVPAEVHHDTRRALAVLRDWSTDERYGSSRLVVLAHGITAGT
DEPSLAAVCGLVRSAQSENTPGRITLLHTDDLARPIDDLVAVTKAAAEPELLVRGDAVLV
PRLARLTTPATATAPDWSAGTTLVTGGTGGLGAALARHLVVEHGARHLALVSRRGLEAPG
AGQLVAELGELGAHVSVAACDVADRSALAEVLATIPADHPLVGVVHAAGVLDDGLVTALS
DEQLETVLRPKVDAAWHLHELTQDLDLSAFVMFSSAAGVLGAAGQANYAAANAFLDALAT
YRRAQGLAGQSMAWGLWADDTGMSAGLSGPDVRRLARTGVVPLTTPVGLSLFDTGSRHDE
AVLIPMHMNLNGIGAIPPMLQGLVRPRVSAARAVTVDKSLRERLLLLPESERGAAVLAVV
CEQVAAVSGGGAIDPDRSFRDLGFDSLMAVELRNALTEVCGAKLSATAVFDYPTPRDLAA
HVRGDLDGTREQVILPTPAVTRDLDDPVVIVGMACRYPGGVSSPDELWQLVVDGADAISD
FPQDRGWTTGSGSSYPRAGGFLHSAADFDAEFFGISPREALAMDPQQRLMLEVSWEAFEH
AGIDPASLRGSRTGVFAGLMYHDYASRAQGSLSEDLVGFLGNGNSGSVLSGRVAYSLGLE
GPAVTVDTACSSSLVALHLAAQALRSGECDLALAGGVTVMATPAAFVEFGRQGALASDGR
CKAFSDTADGTAWSEGVGLLLVQRLSDARRDGRRVLGVVRGSAVNQDGASNGLTAPNGPS
QQRVIRAALAGAGLGVSDVDVVEAHGTGTALGDPIEAQALIATYGQGRVRPLLLGSIKSN
LGHTQAAAGVAGVIKMVMAMRHGVLPRTLHVDEPTSHVDWSAGSVQLVTEQVVWPEVDRP
RRAGVSSFGISGTNAHVIIEAPVAGESPTNNEMRAVPWLLSAKNEEALRAQARRLLTYTE
VHPDTDPADVANVLATKRAVHKHRFALVGDSLDALTKRLRAFVDGEAGSVVADQGMVALL
FSGQGSQVVGMGRGLAESFPVFGSVFGEVCGLVDAELGGSLAEVLWGGDGGVVDRTVFAQ
VGLFAVEVSLFRLLESWGVRPDYLVGHSVGEVAAACVSGVLSLGDAVRLVVARGRLMQGL
PGGGAMVSVAAPVAEVVARVEGVSGVGVAAVNGPRQVVVSGVESVVLGVVEGFAAEGVRT
RRLRVSHAFHSSLMEPMLVEFERVVGGLSFGEPRIPVVSTVTGAVISDEFGTPGYWVRQV
REPVLFADAVRSLESLGVTRFVEVGPGSALTALVHDCLSSDRATLVVPTLRRDTDESSSV
VEAAASLHTAGSVVDWKRFFTDVPARYIDLPTYAFQRKRFWLNAPAAAGDATGLGQVAAD
HPLIAAAVTLPESDSVVFTGRLSLATHPWLADHAISGVSVLPVSALVELVTRAGDEVSTA
TVDNLTALVPLVIPESDSVRIQVSVGPPDDSGRRPVSVFSTTESADQDWTRNARGVLSAD
ARPFEFGVTTWPPADAEAIDLDELYDEMAVDHGPAFHGVRAAWRRGGELFAEVVLPEEEQ
LTAARYGLHPALLDAATHVAAVEFPGAVPATWTGLSRYASGVAELRVRLSKTDGATLSFD
AVDFAGTPVASAEGVALRPADQVRMPGGRASDSMFRVEWQPRPVNESVGSANPWLVLDER
FAQSLASSGIPVSAAVDEPDIVVLACAGEQRTTHAVVSDVLAAIQRWLADERRAASRLVV
VTRGAVPVGELTDLAGAAVWGLVRSAQTEHPGRIVLADVDDSLDALPAALATGEPQFALR
GGAIHVPRLVRVRAPAATDRITGGTILVTGGTGGLGALVARHLVTEHGVQRLLLVSRRGP
DAPGAGELAAELRDLGAEVTVAACDVSDVSALADLLADIPADFPLTGVVHAAGVLDDGVL
TAMTDDRLATVLRPKADAALALHELTKDMDLSLFALFSSVTGVLGAAGQSNYAAANAFLD
ALAEHRRAQGLVAQSLAWGLWEDQEGGMAKTLTAADVRRQSRGGVVPLSAAEGLALFDAA
VSSDGTVVVPVRLRTAGVTGEIPPLLEGLVRPRRDERAPASAKSLRERLSTANENEQYAL
VLGVVRSQIATVLGHDGAHAIEPDKAFRELGFDSLAAVELRNGLNTAVGLSLPTSMVFDY
PTPAALSRHLHTELVSGTRGAADPDDGIRQVLAGIPVDRIRQAGVLEILLRLADPASDVP
PGAGSSTSIDDMDAESLLRLAAENSSG
NT seq 20424 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgaggggaggctgttcgagtacctcaagcgtgtcacggcagacctgcgccag
gcgcgaggtgagctcgcgggccaccgcgagccgatcgcgatcgtcgggatggcgtgccga
ttccccggtggcgtcaccacacccgagcagctgtgggacctggtcagcgcgggcggcgac
gcgatgggcgagatgccggacgaccggggctgggacctggccgggctgtaccaccccgat
ccggagcacaccgggaccacgtacacgcgggcgggtggtttcctgcccgacccgggtggt
ttcgacgccgagttcttcgggatcacgccgcgcgaggcgatggcgaccgatccgcagcag
cggatcctgctcgaagtcacctgggaggcactggaacgcgccggtatcccggcggactcc
cgccgcggcagccgggtcggtgtgttcgtcggcacctcggggcaggactacgcgacactg
ccgagctcaccgcaggtggagggttacctcgcggcgggcaacgcggccagcctgatgtcg
ggccggatcgcctactcgttcgggttcaacggcccggcagccactgtggacacggcatgt
tcgtcgtcactggtggccatgcacctggccgcgcaggctctgcgcaacggcgagtgttcg
ctcgcggtggccggtggtgtcacgctgatgacatcgcccaacttgctggtcgagttcgcg
cgtcaacgcgggttgtcaccagatggacgctgcaaggcgttcgccgccgccgctgatgga
acgggtttcgccgacggtgtcggtgtgcttctgctcgcgcggttgtcggacgcggaacgc
gaagggctgcctgttctggcggtcatccgcggtagcgcggtgaactcggacggcgcctcc
aacggcctgacggccccgaacgggcgtgcccaggaacaggtcatccggcaggcgctggcg
aacgccgggctcagcctgtcggacgtggacgcggtggaggcgcacggcactggcacgacg
ctcggcgaccccatcgaggccgaggcgcttctggcgacctacgggcagggccgggacgag
ccgctgtggctcggttcggtcaagtcgaacatcggccacacccaagcggctgccggtgtc
gccggtgtgatcaagatggtgatggcgttccgcaacggcctgctgcccaggacattgcac
gtggacagcccgacgccgcacgtggactggacgagtggccaggtgcggctgctcaccgag
aaccagccatggcccgaggcgggccgtccgcgccgagccgcagtgtcctcgttcggcgtg
agcggtacgaacgcgcacctgatcctcgagcaggctgtcactcgcgtgcaggctgcggct
ccggccgatcgtgtcgtgccgttgttgttgtcggctcggaccgaaccggcgctgcgcgac
caggcacgtcggctgctgaccgccctgcgcgatgacatgtctgttgtggacatcgggcac
accttggcgaccgggcgttcggcgctggagtaccgcgcgcaggtcgtcgccggtgacgtc
gacgacctgcgcgcggtcctcgccgcggtcgcggacggcggtggccaggtcggcgtggtg
gacaaccccggccgggtcgctttcgtcttctccgggcagggagcacagcgcctggacatg
ggaacggttctgtaccaggcgttccccgtcttcgcggacgcgttcgacgaggtctgctcg
cggctggaccccggtctgcgggaggtcgtccggtccgaccggcaccggctggatcggacc
gagttcgcccagcaggccctgttcgcgttcgaagtggcgctggctcggctgttcgagtcg
atcggcgtcaggccgagtgtcgtggccggtcactcggtcggcgaggtggccgcggcgcac
gtggccggagtgctcgacctcgacgacgcctgcgcgctggtggccgcccgttcccggctg
atgcaggaatgccgccaggacggcgtgatggccgcggtgcaggcctcggaggaggagatt
cacgagcacctgtccggtgaagtcgcactcgcggcggtcaacgcgccgcaagccgtggtg
atctccggtgacgccgacgcggtgcgccgggtggcggaccactgggcttcgctggggcgc
aagaccaccgagctgcgcgtgtcgcacgccttccactcccaccacatggaccaggcgctt
cccggcttccggcaggcgctggcgggtttgacgttccggtccccgagcatcgcgatggtg
ccgacctcgaacggtgacgtcaccacagccgagtactgggtggcgcagttgcggtcgccc
gtccggttcgagcacgccgtgcgaacaatggccgagcgcgggaccagcgtgttcctcgaa
gttggtccgggagccccgctcaccgcgctcggcgggcacttcgactcaggcgcggctttc
atcgcggcacaacgggacaagggcgaagaagcgaacaacctcgcctccgctctcgcgcag
ctgcatgttgccggggtgcgctgggagtgggacgcggcgttccctggcggcaggaagatc
cagctgcccacctacgcgttccagcacgagcactactggatgccaccgacctcgggtgcc
ggtgacgtcgaaacggcgggactgctgaccgccggacacccgctgctgagcgccgtgacg
gatcttggtgatgacggctgtgtgctgacgggtcgcgtctcgttgtccacccactcgtgg
ctggccgaacaccgcatcctcggcaccgtggtcgtgccgggtaccgcactggtcgagatg
gccgtgagcgccggtcgccggtttggctgcgcccacctcgccgagctgacttcccgaacg
ccgttgacgctgcccgagacggaagccgttgtcgtgcaggtccgggtcggcgcgggcggt
gactctcggccggtgtcgatctcgtcgcgggcagtggactccgccgagtggacgctgcac
gccgaaggtgtcctgaccgaggacagcgcggtcggcgatgagtcgtatccgaccgcgtgg
ccgcccgctggcacctccccagtggacgtcacgaccgtgtacgaccgcctcagcgacgac
ggatacggctacggcagcgttttccgagggctccgcgcggcctggcgccgcggcgacgag
ttgttcgccgaggtggccgtgcccgaggacaccgacgtcgccggcttcgacgtccacccg
gccctgctcgacgcggcgctgcacgtgatgctggtggacgcccgtgaaggacaggtctgg
ctgccgttctcgtggtcgggcgtgtcggtctggccgggaacaccgaggcgcctgcgtgtc
cgggtgtcgccggtgacccgtgacacggtgtccgtcctggtcacggacacggctggggaa
cccgtggcggcagtccggagactgaccggtcgcgccgcctcggcacgtgacatccagccc
gccagggtgaacgtccgcgactggttgttgcggccggattggttgccggtgcggacaccg
caaggagctgcccggttcacgtggcttggaccggacgccgatctggcgtcgatcactgcg
cccggcgatgtggcggtcgtggtcggtgcggacggcgacgccatgacagccgggtacgcg
ggcgtccaccgtgttctgacgctcgtgcgccaatggctgcgagacgagcggttcgcctcg
gcccgtctcgtcgtggtggtccgaccggctgactgggccgctgccggtgtgtgggggctg
gtgcgttcggcgcagaccgaacaccccggccggttcgtcctggtcgaatccgatgccacc
ggtgaggccctgctaccggctgcgctggcgggaggcgagccgcagctcgcgatccgcgag
ggccgggtgctggtgccccgcctggtccgggcacaggcaggcggcgagccggtcgcactg
aatccgggcggcacagtgctgatcaccggtggaaccggtgttctcggtggtctgctggcc
cggcatctggttgccgagcacggtgtccgccacctggttctcgctggtcgcagcgggcgt
gccgacgtcgccgacttggacgcggacgtacgagtggtggcgtgcgacgtctccgaccgc
gacgacgtgcggttgctgctggacgggattcccgccgagcacccgctgaccgcggtcatc
cacgcagccggtgtccttgacgacggtgtcgtggagacgatgacgtcgcagcggatcgtc
gacgtcttcgggcccaaggtgggcggcgcgtggcacttgcacgagctgaccgaggagttg
gacctcgaggcgttcgtggtgttctcgtccgccgccgggctgttgggctccggcgggcag
gcgaactacgccgccgccaacaccttcctggacgccatcgccgtacatcggcgctcccag
gggcttgcggcccactcgctcgcgtggggcatgtgggagcccaacggcggcatgaccgga
ggactggacgcgaccagccgtgcgcgcttcgcccgcggcggtatcgcgccgttcaccgcc
acggacggactcgcgttgttcgacctcgcgttgagcacggacgacgcagtgctggcaccg
gcccgcttcgatctgacgaacgtgccggacccggcacctgccgtgctgcgtgaactcgtc
cggcgttccacctcgaacccggtgccgaacccaggttcgcggtcaccgcgtgaccgcatg
gcgcgcctgtcaccacctgagcggcaggacgcggttctcgcgctggtccgtgaccaggtc
gcggtggtcgtgggatacccggacggtgccgcggtcgacgcggaccgcccgttcaaggac
ctcgggttcgactcgctgatgtccgtggaactgcgcaacggcttggtctcgctgaccggt
gtccggctatcggcgactgccgtgttcgactacccgaccccacgggggctggcggtccac
ctgcacgccgcactgttcggcgccgacgagaaactgccccgccaggtgaccgcggtggtc
caggacgacgacccgatcgtgatcgtcgggatggcctgccgctacccgggcgggatcacg
tcaccggaagacctgtgggacctggtcgccgcgggaaccgacgcggtgtcggagttcccg
gccgaccgcggctgggacccgggactctacgatcccgaaccagggcggaccggccacagc
tacacgcgccacggtgggttcctgcacgacgccgcggacttcgacgcggagttcttcggg
atctcgccgcgtgaggcgttggcgatggatccgcagcagcggttgttgctggaggtgtcg
tgggaggttgtggagcgggctgggattgatccggtttcgttgcggggtagtcggactggt
gttttcgtaggtgtgatgtaccacgactacggcactcggatcggcgcggtggccgacgat
gtcgaaggatatgtgggtacaggcacgtcaggaagtgtcgcttcgggtcgtgtggcctac
acgttgggtcttgagggtcctgcggtgacggtggacacggcgtgttcgtcgtcgttggtg
gcgttgcatttggcggcgcaggcgttgcgttccggtgagtgcgatctggcgttggccggt
ggtgtgacggtgatggccacacctacgacctttgtggacttcagcagacagcgcggtctc
gctccggatggccgctgcaagtcttttgcggctggtgctgatgggacgggttggtccgag
ggtgctggtttgttgttggtgcagcgtttgtcggatgctcggcgtgatggtcgtcgggtg
ttgggtgtggttcgtggtagtgcggtgaatcaggatggtgcgtcgaatggtttgacggct
ccgaatggtccgtcgcagcagcgggtgattcgtgcggcgttggcgggtgctggtcttggt
gtgtctgatgtggatgtggtggaggcgcacggtacgggtacgaggctgggtgatccgatt
gaggcgcaggctttgcttgcgacgtatggtcagggtcgggttcgtccgttgttgttgggt
tcgatcaagtcgaatcttggtcatacgcaggcggctgctggtgttgctggtgtgatcaag
atggtgatggcgatgcggcatggtgtgttgccgcggtcgttgcacgtcgacgagccgaca
ccgcacgtggactggaccgctggttccgtcgagttgttgactgagcgggttgtgtggccg
gaggtggatcgtcctcggcgggctggtgtgtcgtcgttcggtatttccggcaccaacgcg
cacatcatcatcgagcaggtgccgacgggagaggagccgacggacaacaccccggccacg
ccgttgccttgggttctttcggccaaatccgaccgggctctgcgcgtacaagcggaacgc
ctccgtacatgggcgagccgctccccaggaagctctgtcgccgacatcgggtattcgttg
gcgacaggacgagcagcattaaaccaccgcgcggtggttgtcgggacggaccgctcggac
ttcctgcgtggattggaaaccatcgcaacaggcacctcgcccggcgaccgcatcgcggag
ggaatcgccggcagcggcaaactggccctgctttttcctggtcagggttcgcaggtggtg
gggatgggtcgtggtttggcggagtcgttcccggtgttcggttcggtttttggtgaggtg
tgtgggttggttgatgctgagttgggtggttcgttggctgaggtgttgtggggtggtgat
gggggtgtggtggatcggactgtgtttgctcaggttggtttgttcgcggttgaggtgtcg
ttgtttcggttgttggagtcgtggggtgtgcggccggattatctggtgggtcattcggtg
ggtgaggttgctgcggcgtgtgtgtcgggtgtgttgtcgttgggtgatgcggtgcggttg
gtggtggcgcgtggtcggttgatgcaggggttgccgggtggtggggcgatggtgtcggtg
gcggcgccggtggcggaggtggttgctcgggttgagggtgtgtcgggtgttggtgttgcg
gcggtgaatggtcctcgtcaggtggtggtttcgggtgttgagtcggtggtgttgggggtt
gttgagggtttcgcggcggagggtgtgcggacgcgtcggttgcgtgtgtcgcatgcgttt
cattcgtcgttgatggagccgatgctggtggagttcgagcgggttgttggtggcctctcg
ttcggtgagccgcggattccggttgtgtcgacggtgggtgccggactggacatgagcacc
cctcagtattgggttcggcaggtccgtgagcctgtgctgttcgctgacgccgtggcacgg
gtggcggagcagggcgtcacgaggttcgtcgaagccggtccgggcagcgctttgtccaca
atggtcgagagctgtctcgcagacctcgaagaaggtgctgcggtcgcactgctgcgccgt
aaccagcccgaatcgcagtcggtcatcgacggtatcgctcgcctgtacgtcaacggcgta
ccgctcagcctggcaccggtattcggcagggcacgcacagtcgacctgcctacgtacgcc
ttccaccgcaagcgttattggccgacaggcgacgctgtggcgacgggtagcgccggatct
gggcacccgttgctttcggccgcggtcgtgctcgcggactcaggcggtgcgttgctcacc
ggcaagctgtccctggcgtcccatcagtggctggtggaccacgccgtgcgaggcgtatcc
ctgttcccggggacggggttcgtcgagctcgccgctcatgccggtggttgcgtcgactac
ccggtcgtcgacgagctgacgatccaggcgccactggctatgcccgagcagggcgctgtg
gagctgcagatctctgtcggcgaggagaagtcgggccagcgcgaggtgcgcgtgtactcc
cgcatcgccggtgcctcggccgaccagtcctggacgtgtcacgcgtcgggcaccttggtt
ccggcacgtccagccactcgtcgcgacgacgtgacctcctggccacccagcggagcacga
gccgttgacgtcgacggcctctacgaagacctggccgcggcaggactggactacgggcct
gccttccacggtgtgcagcgcgtgtggcgcagggaccacgagctgttcgccgagctcgcc
ctgccggacggagatctcgtcggtggatcccggttcggtctgcaccccgccctcttcgac
gcggcgctgcacgtggcgcggctgtccgatcgggcctgggacgggacagggtcgaagttg
cccttctcctggagcggtttcgagctcaacaaggccggtgccaccgagctcaggctgaag
ctgaccagcacggactctggtgcgctttcgctggccatgaacgacatcgacgggtcgccg
gtggcatccgtcgagtccgtcgtcctgcgcccggtgacggctgaacaactcgcggcagct
cagaccggccactccgagccaatgcacaggtcggagtgggtggccgtcacgacaccagcg
ggcgccgtccagtcatgggcgtggtgggggctggaaagcctggcgaacgcgaacgccgac
gtgatcgtcctgccattccttactggctccgaccacgacgacaccgtggacagggtgcac
gcgacgacaacggccgctctcgacgccgttcagcagtggttgtcggatgtccgcttcggc
tcgtccaagctggttgtgctgacgcagaacgcggtttccgctggtggaagctcgcgaccg
gtggatctggccggcgcggcggtgtgggggttgatccgctcagcccaactggagcacccc
ggccgaatcgtcctggtcgacgtcgacgagcctgacgaggccgcggctgcgctggcgtcg
gctctccgcacgggcgagaaccaggtggcgatccgcggcgactctgtgctcgggcatcgg
ctggttccagtcgtgcgcacgaccgtggacgaggttcccgcgtggcgggggactgtcctg
gtgaccggtgggacgggtgggcttggtgcgttgatcgccaggcacctggtcacggtccac
ggggtcgaacggcttgttctggtgagcaggcggggaacggacgcaccgggcgctgccgaa
ctggtcgacgagttgactgcgctcggcgcgcacgtcgacgtggctgcctgcgacacgagc
gaccgcgccgcactggcccaggtgctggcaacgatcccggccgaccatccgttgggcggg
atcgtgcacaccgcgggagtcctcgacgacggtgtgctgaccgccctgtcacccgagcga
ctggctcttgtgctgcgcccgaaggtggatgcggcctggcacctgcacgagctgacgaag
gactcggacctgggcgcgttcgtcctcttctcgtccgccgccggggtgatcggcgcggca
ggacaggccaactacgcggcagccaacgcattcctcgacgcactcgctgtccaccggcgg
gaacaggatctgccgggacagtcgctggcctgggggttgtgggcgaacaccgacggtggc
atggcaacacggatgtccgaagcggacaccgagcggctcacccgcgctggtgtcacggcg
ttgtccgcgccggaaggactggcgctgttcgacgcggcaggccgcaacggccacccggtc
ctggtccccatgcggctcgctccagcgaagcgggcacgggagaccgcccccgccggcggc
acgacgttccgccgtcagctctccggcatggacgcgtccgctcgtctgcgaaccgtgcag
gacctggtgctcgcacagacagccgcggtgctcgggcacgcgtcggccgccgaaatccac
cccggccgtgctttccagggcctcggcttcgactcgctcacagcggtcgaactgcgcaac
gggttgtccaccgccacacggctgcggctgcccgcgaccctggttttcgaccacccgaat
cccgccgccctggccgagtacctggtgtccgaattggtcggtgaaccggccgagtccgag
gtcggcgaagcgccgcaggtgctcgacgacgacccgatcgtgatcgtcgggatggcctgc
cgctacccgggcgggatcacgtcaccggaggacctctggcgattggtctcgaccgacggg
gacgcgatatcggagttcccggccgaccgcggctgggacggcgacggcctgtacgacccg
gacgcctcccggtacggcaagtccgccacccggcacggtgggttcctgcatgacgccgcg
gattttgacgcggggttcttcgggatctcgccgcgtgaggcgttggcgatggatccgcag
cagcggttgttgctggaggtgtcgtgggaggttgtggagcgggctgggattgatccggtt
tcgttgcggggtagccggactggtgtgttcgctggtgtgatgtaccacgactacggcgcc
cggatggctgatgtcgacgacgccgagggatacgtggggacggggaactccggcagtatc
gcttccggccgtgtggcgtatgcgttgggttttgagggtcctgcggtgacggtggacacg
gcgtgttcgtcgtcgttggtggcgttgcatttggcggcgcaggcgttgcgtacgggtgag
tgtgatctggcgttggccggtggcgtgaccgtgatggcgactccggctgcattcgtggga
ttctcccggcagggcggtctttctccggatggccgctgcaagtcttttgcggctggtgct
gatgggacgggttggtccgagggtgttgggctgcttcttgtgcagcgtttgtcggatgct
cggcgtgatggtcgtcgggtgttgggtgtggttcgtggtagtgcggtgaatcaggatggt
gcgtcgaatggtttgacggctccgaatggtccgtcgcagcagcgggtgattcgtgcggcg
ttgcggaactcgggtttgtccgctgtggatgtggatgcggtggaggcgcacggcacgggg
acgaaactgggtgatccgattgaggcgcaggctttgcttgcgacgtatggtcagggtcgg
gttcgtccgttgttgttgggttcgatcaagtcgaatcttggtcatacgcaggcggctgct
ggtgttgctggtgtgatcaagatggtgatggcgatgcggcatggtgtgttgccgcggtcg
ttgcacgtcgacgagccgacaccgcacgtggactggaccgctggttccgtcgagttgttg
actgagcgggttgtgtggccggaggttgatcgtcctcggcgggctggtgtgtcgtctttc
ggtatttccggcaccaacgcacacgtcatcatcgagcagccgtccgagccgactgcggag
tcctcggcggccgatcccgacctcgtcgtctggtccgtgtcggcgcgatcacccgaagcg
ctgcgagcacaagcgaatcgacttctgtctcatgtggatgcgcatccggaaacggccgct
ggtgaagtcggtcggtcgctggcgaccgccagagcgcacctggagtttcgcgcgagcgtc
atcggggctgaccgcgaagagctgaggcatggcctggcggcggtcgcagccggtgaactg
gtggacggcattttcgctggacgcgagcagaccggatcgaccggattcctgttccctggt
cagggttcgcaggtggtggggatgggtcgtggtttggcggagtcgttcccggtgttcggt
tcggtttttggtgaggtgtgtgggttggttgatgctgagttgggtggttcgttggctgag
gtgttgtggggtggtgatgggggtgtggtggatcggactgtgtttgctcaggttggtttg
ttcgcggttgaggtgtcgttgtttcggttgttggagtcgtggggtgtgcggccggattat
ctggtgggtcattcggtgggtgaggttgctgcggcgtgtgtgtcgggtgtgttgtcgttg
ggtgatgcggtgcggttggtggtggcgcgtggtcggttgatgcaggggttgccgggtggt
ggggcgatggtgtcggtggcggcgccggtggcggaggtggttgctcgggttgagggtgtg
tcgggtgttggtgttgcggcggtgaatggtcctcgtcaggtggtggtttcgggtgttgag
tcggtggtgttgggggttgttgagggtttcgcggcggagggtgtgcggacgcgtcggttg
cgtgtgtcgcatgcgtttcattcgtcgttgatggagccgatgctggtggagttcgagcgg
gttgttggtggcctctcgttcggtgcgccgcggattccggttgtgtcgacggtgggtgcc
ggactggacatgagcacccctcagtattgggttcggcaggtccgtgagcctgtgctgttc
gctgacgcggtgaaccacttggcggcggagggcgttcgccggttcgtggagatcggcccg
ggtacggccttgaccgttctggcgaaggagaacctcgtcgattcgcaagcggtggtcctg
ccgaccctgcggcgaggcgaggacgaacctcggcaggtggtcgaagcgatcgccggtctg
cacgtctccggggcttcgctcgaatgggcccggttcttcgcaggtgtcaaccaggtcgac
ctgccgacctatgccttccaacacaggcgatactggtacgacgtcccagtcgggcaaccc
ggcgacatcaggaacgtcggccagcaggcggtcacgcatcccctgctcggcgcggccgtg
gccctgcccgcaacgggcgggatggccttcaccgggcggttgtcggtggccacgcagctg
tggttggccgaccacctcgttgccgggattgtgctcttcccggcaaccgggttcgtggaa
ctagcgcggcacgcgggcgacgagctgggatgtccggtcgtcgaggagctgtcgatccag
gcaccgctggtgatgcccgccaacgcggcggtcagcgtgcaggtgtcggtcggccaggtc
ggtgacgacggccgcagaaccgtcagcgtctactcccggcctgaggacaccgccgctgac
cagaggtggacgtgtcacgcgacaggtgagcttgcgagcccgatcgcgatccccctccag
caggactcgtcggcgtggccgccggtcggtgctctggctgtggacccggatgcgctgtac
gacaagctcgcggcgcgcggactcgactatggtccggtgttccgcggcgttcgggcggcc
tggcagcgcggcgaggagctgttcgccgaagtggacctgccggaggacgagcacccggcg
gccacccgttacggcctgcatccggcgttgttcgacgcggcgttgcatgtcgctgctgtg
aacggtgaagcggctgcgttgccgttcgcgtggaccggggtgaccctccacgcggcgggg
gccaccgcgttgcgcgtcagcgtcgtcacgagcggtgagaacacgatggcgatccacttg
gccacgcaggacggcatcccggtcgcggacgtcggctcgttggtgtcgcgacccatctcg
cccgagcagttggccgccgcccggacagaccacgacgacctcctgttccgcaggaactgg
gtgccgatcacgccgccgcagccgacagccgagccggaaacgtggtcctggtacgcgcag
gacgggcccgtcgccgacgtgctcgtcatcgcgttcaccgccggaggtgcttcggacgtc
ccggctgaagtgcatcacgacaccaggcgggcactcgcggtgctccgggactggtcgacg
gacgagaggtacggatccagccgtctggtggtgctggcccacggcatcacagcgggaact
gacgagccgtccctcgcggcggtgtgtggcctggtgcgttccgcgcagtcggagaacacg
cccgggcggatcacactgctgcacaccgacgacctggcccgcccgatcgacgacctggtc
gcggtcacgaaggcagcggccgaacccgaactgctcgttcgcggagacgcagtcctcgtg
ccgcggctggcccggctcaccacaccggccaccgcgaccgcgccggactggagtgccgga
acgacgctcgtgaccggcggaaccggtggcctgggagcagcgctcgcccggcacctggtc
gtcgaacacggtgcgaggcacctggcgttggtgagccgtcgcggcctggaagctcctggc
gccggccagctcgtggccgaactcggtgaactgggtgcgcacgtgagcgtggcggcctgt
gacgtggctgaccgatccgcgttggcggaagtgcttgcgacgatccctgccgaccacccg
ctggtcggtgttgtgcacgcggcaggtgtactggacgacggcctggtcaccgcactgagc
gacgaacagctcgagacggtgttgcggccgaaggtcgatgccgcctggcacctgcacgag
ctgacgcaggacctcgatctgtcggccttcgtgatgttctcgtctgcggccggtgtgctc
ggtgccgccgggcaggcgaactatgccgccgccaacgcgttcctcgacgcactggcgacg
taccggcgcgcgcagggcttggcagggcagtccatggcgtggggtttgtgggctgacgac
accgggatgtcggccggactgagcggccccgacgtgcgacgcctggcacgcaccggagtg
gttccactgaccacgccggtagggctgtccctgttcgacacgggatcacggcacgacgaa
gccgtgttgatccccatgcacatgaacctcaacggcatcggcgcgataccgccgatgctc
caaggactggtgcggccacgggtgtctgccgcgcgtgccgtcacggtggacaagtccctg
cgtgagcggcttctgttgcttcccgaaagcgagcggggagcagcggtgcttgccgtggtg
tgcgagcaggtggccgcggtcagcggcgggggagcgatcgacccggatcgttcgttccgg
gacctgggcttcgactcgctcatggcggtcgaactgcgcaacgccctgacagaggtctgc
ggcgccaagttgtcagccacggcggtgttcgactaccccacgccacgggacctcgccgcc
catgtccgaggtgacctggacggcacgcgggaacaggtcatcctgcccaccccggcagtc
acccgggatctcgacgatcccgtcgtgatcgtgggcatggcttgccgttacccgggtggt
gtctcgtcgccggacgagctgtggcagctggtcgtcgacggggccgacgcaatttcggac
ttcccgcaggaccgcggctggaccaccggttccggcagctcctacccgcgtgcgggcggg
ttcctgcactcggcggcggacttcgacgcggagttcttcgggatctcgccgcgtgaggcg
ttggcgatggacccgcagcagcggttgatgctcgaagtctcgtgggaggcgttcgaacat
gccggaatcgaccccgcttcactgcggggcagccggactggcgtgttcgcgggcctgatg
taccacgactacgcgtccagagcacagggttcgttgtcggaggacctggttggattcctc
ggcaacgggaactcgggaagcgttctgtcgggtcgtgtggcgtattcgttgggtcttgag
ggtcctgcggtgacggtggacacggcgtgttcgtcgtcgttggtggcgttgcatttggcg
gcgcaggcgttgcgttccggtgagtgcgatctggcgttggccggtggcgtgaccgtgatg
gcgactccggctgccttcgtcgagttcggtcggcagggtgcgctggcctcggatggacgt
tgtaaggcgttctcggacactgccgacggtactgcttggtccgagggtgttgggctgctt
cttgtgcagcgtttgtcggatgctcggcgtgatggtcgtcgggtgttgggtgtggttcgt
ggtagtgcggtgaaccaggatggtgcgtcgaatggtttgacggctccgaatggtccgtcg
cagcagcgggtgattcgtgcggcgttggcgggtgctggtcttggtgtgtctgatgtggat
gtggtggaggcgcacggtactgggactgctttgggtgatccgattgaggcgcaggctttg
atcgcgacgtatggtcagggtcgggttcgtccgttgttgttgggttcgatcaagtcgaat
cttggtcatacgcaggcggctgctggtgttgctggtgtgatcaagatggtgatggcgatg
cggcatggtgtgttgccgaggacgttgcatgttgatgagcccacgtctcatgtggactgg
tctgctggttcggttcaactcgttaccgagcaggttgtgtggccggaggttgatcgtcct
cggcgggctggtgtgtcgtcgttcggtatttccggcaccaacgcacacgtcatcatcgag
gcacccgttgccggggagagcccgaccaacaatgagatgcgtgcggttccttggcttttg
tccgccaagaacgaggaagcgcttcgtgcccaagctcgtcggctgctgacctacaccgaa
gtccacccggacaccgacccggctgatgttgccaacgtcttggccaccaagcgcgccgtg
cacaagcaccgattcgctctcgtcggcgacagtctcgatgcactgaccaagcgcttgcgt
gcttttgtcgacggcgaggccggttcggtcgtggccgaccagggcatggtggccttgttg
ttctctggtcagggttcgcaggtggtggggatgggtcgtggtttggcggagtcgttcccg
gtgttcggttcggtttttggtgaggtgtgtgggttggttgatgctgagttgggtggttcg
ttggctgaggtgttgtggggtggtgatgggggtgtggtggatcggactgtgtttgctcag
gttggtttgttcgcggttgaggtgtcgttgtttcggttgttggagtcgtggggtgtgcgg
ccggattatctggtgggtcattcggtgggtgaggttgctgcggcgtgtgtgtcgggtgtg
ttgtcgttgggtgatgcggtgcggttggtggtggcgcgtggtcggttgatgcaggggttg
ccgggtggtggggcgatggtgtcggtggcggcgccggtggcggaggtggttgctcgggtt
gagggtgtgtcgggtgttggtgttgcggcggtgaatggtcctcgtcaggtggtggtttcg
ggtgttgagtcggtggtgttgggggttgttgagggtttcgcggcggagggtgtgcggacg
cgtcggttgcgtgtgtcgcatgcgtttcattcgtcgttgatggagccgatgctggtggag
ttcgagcgggttgttggtggcctctcgttcggtgagccgcggattccggttgtgtcgacg
gtgaccggtgcggtgatttccgacgagttcgggacacctgggtactgggttcggcaggtc
cgtgagcctgtgctgttcgctgatgccgtgaggtcgttggagtcgttgggggttactcgg
tttgtggaggtggggccagggtctgcgttgacggcgttggttcatgactgcctgtcctca
gaccgggccactctggtggtgcccaccctgcgacgggacaccgacgagtcttcgtccgtc
gtggaagctgccgcctccttgcacacggccggttccgtcgtggactggaagcgcttcttc
accgacgtccccgcacgctacatcgacctgcccacctatgccttccaacgcaagcgcttc
tggctgaacgcccctgctgccgcgggcgacgcgaccggtctcggacaggtcgccgccgac
cacccgctgatagccgccgcggtcacgctgcccgaatcggacagcgtggtgttcaccggc
aggttgtcgctggccacacatccctggctggcggaccacgcgatctcaggtgtgtccgtc
ctgccggtctcggcgttggtcgagcttgtgacgcgggcaggtgacgaggtcagcactgcc
acagtggacaacctcacggcactcgttccccttgtgatccccgagtcggacagcgtgcgg
atccaggtgtccgtcggcccgccggacgactccggtcgtcgcccggtcagcgtgttctcc
acgacggagtccgctgaccaggactggacgcgcaacgcccgtggagtgctgagcgccgac
gcgcgaccgttcgagttcggcgtgaccacctggccaccggctgatgcggaagccatcgac
ctggacgagttgtacgacgaaatggccgtcgaccacggacccgcgttccacggcgtacga
gcggcgtggcgacgtggcggcgagttgttcgccgaagtcgttctgccggaggaggagcag
ctcaccgccgcgcgctacggcctgcacccggcactgctcgacgcagccacacacgtcgcg
gcggtcgagttccccggtgcggtaccggcaacgtggaccggcctgtcccggtatgcctct
ggtgtcgccgaactccgggtccgcctgtccaaaacggacggtgcgacgctgtccttcgat
gccgtggacttcgccggtacgccggtggcgtctgccgagggcgtcgcgctgcgcccggcc
gaccaggtccgaatgccgggcggccgggcgtcggactcgatgttccgcgtcgaatggcag
ccgcgaccggtcaacgagagcgtcggctccgcgaacccgtggctggttctcgacgagcgg
ttcgcgcagtccctggcgtcgagtgggatccctgtcagcgccgccgtggacgagccggac
atcgtggtgctcgcttgcgccggagaacagcggaccacgcacgcggtcgtcagcgacgta
ctggcggcgatccagcgctggctggccgacgaacgccgggcggcgtcacgactggtggtg
gtcacgcgtggcgcggtgccggtcggggagctcacggacctcgctggtgcggcggtgtgg
gggttggtgcggtccgcgcagaccgaacaccccggccggatcgtgctggcggacgtggac
gattcgctcgacgcgctccccgcggctttggccaccggtgaaccgcagttcgcgctgcgc
ggcggtgcgatccacgttccccggttggtccgcgtgcgagccccggccgcgacagaccgg
atcaccggcggaacgatcctggtcaccggtggcaccggcggtctcggcgctctggtggcc
cggcacctggtgaccgaacacggggtccagcggttgctgctggtgagccgccggggacca
gacgccccaggcgcaggggaactcgccgccgaactccgtgatctcggtgccgaggtcacc
gtcgcggcgtgtgacgtgagcgatgtctccgcgctggcggacctgctggcggacatcccg
gccgacttcccgctgacgggtgtcgtccatgccgctggagttctcgacgacggcgtgttg
accgcgatgaccgacgaccggctggccactgtgctgcgccccaaggcagacgccgccctg
gccctgcatgagctgacgaaggacatggacctgtccttgttcgcgctgttctcgtccgtc
acgggcgtgctgggcgctgcggggcagtcgaactacgcggcggcgaacgctttcctcgac
gcactggccgagcaccggcgggcacagggccttgtggcgcagtcactcgcttggggactg
tgggaggaccaggagggtgggatggccaagaccctcaccgccgccgacgtgcgcaggcag
tcgcgtggtggagtcgtgccgttgtcggcagctgaaggactcgcgttgttcgacgcggcc
gtgtcctcggacggcaccgtcgtggtgccggttcggttgcgcactgcgggcgtcaccggc
gagattcctccgttgctggaagggctcgtgcggccacgccgggacgagcgtgctccggcg
agtgccaagtcattgcgtgagaggttgtcgacagccaacgagaacgagcagtacgcgttg
gtgctcggcgtggtccgcagccagatcgcgacagtgctcggccacgacggtgcgcacgcg
atcgaacccgacaaggccttcagggaactcggtttcgactcgctcgccgcggtcgagctg
cgcaacgggctcaacaccgccgtcgggctgtcgctgccgacgagcatggtcttcgactac
ccgacaccagccgcgttgagcaggcacttgcacaccgaactggtgtccggcacgcgggga
gcggccgatccggacgacggcatccgccaggtcctcgccggtatcccggtcgatcgaatc
cgccaggccggggtgctcgagatcctgctgcggctggccgatccggcgtcggacgtcccg
ccgggtgccgggagcagcacatcgatcgacgacatggacgcggagagcctgctgcggctc
gcggccgagaactcttcgggctga

DBGET integrated database retrieval system