KEGG   Kibdelosporangium phytohabitans: AOZ06_39920Help
Entry
AOZ06_39920       CDS       T04088                                 

Definition
(GenBank) hypothetical protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
kphy  Kibdelosporangium phytohabitans
Pathway
kphy02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:kphy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AOZ06_39920
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kphy02000]
    AOZ06_39920
Transporters [BR:kphy02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    AOZ06_39920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_8 SBP_bac_11 SBP_bac_1 TPPK_C
Motif
Other DBs
NCBI-ProteinID: ALG12210
UniProt: A0A0N9IBI8
LinkDB All DBs
Position
complement(8964349..8965464)
Genome map
AA seq 371 aa AA seqDB search
MEFSRTKLRASALAITAGLLAALTACASAGATKSSSPIEVPGASPEANKYMNELYDKAFA
AGNTQLVLYGPGVTANQALNDVFTNRFPGIKLLPQDQADAQTLTKLDAEAQSGKRIADIY
VGGESPQAAAKPNICTTVDVRTADPGFTIPTENDGRLIYFALRYFGFVYNVNEVKEQDAP
KSWHDLLDPKWKGKIAVGDMTVPGGIRYILTSLMLPENEQKWGRAYMRDLAGQNLQISQS
EPMVPTDVASGRFPIGIAVYSGYYEDQKKKGAPIGMVFPLQDGGNFMARSALCAIKDAPH
AEAAQLYVNWLYSPEGQKALAEKDNSYGRTPTAPGPAGLPSLDKLSRLPFSNPDPAFNKP
YFDFINQAFKK
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggagttctcccgcacgaaactgcgcgcgtccgcgctggcgatcaccgccggtctgctc
gccgcgctcaccgcctgcgcgtcggcaggcgccaccaaatcgagctcgccgatcgaggta
cccggcgcctcacccgaggccaacaagtacatgaacgagctgtacgacaaggcgttcgcg
gccgggaacacccaactcgtgctgtacgggcccggggtgaccgcgaaccaggccctgaac
gacgtgttcacgaaccgcttccccggcatcaagctgctcccgcaggaccaggccgacgcc
cagaccctcaccaagctcgacgccgaggcgcagagcggcaagcgcatcgcggacatctac
gtcggcggcgaatcgccccaggcggcggcgaagccgaacatctgcacgaccgtggacgtg
cgcaccgccgatcccggcttcacgatcccgaccgagaacgacggcaggctcatctacttc
gcgttgcgctacttcggtttcgtgtacaacgtcaacgaggtcaaggagcaggacgcgccg
aagtcctggcacgatctgctcgatccgaagtggaagggcaagatcgcggtcggcgacatg
actgtgcccggcggcatccgctacatcctgacctcgctgatgctgcccgagaacgagcag
aagtggggccgcgcctacatgcgggacctggcgggccagaacctgcagatctcgcagtcg
gagccgatggtgcccacggacgttgccagcggccggttcccgatcggcatcgccgtgtac
tcgggttactacgaggaccagaagaagaagggcgcgccgatcggcatggtgttcccgctc
caggacggcgggaacttcatggcccggtcggccctgtgcgccatcaaggacgcgccgcac
gccgaggccgcgcagttgtacgtcaactggctctactcgccggagggccagaaggcgctg
gcggagaaggacaactcctacggccggacgccgaccgcacctggcccggccggtctgccg
tcgctggacaagctttcgcggctgccgttctccaaccccgatcccgcgttcaacaagccc
tacttcgacttcatcaaccaggcgttcaagaagtga

DBGET integrated database retrieval system