KEGG   Kibdelosporangium phytohabitans: AOZ06_47840Help
Entry
AOZ06_47840       CDS       T04088                                 

Definition
(GenBank) superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
kphy  Kibdelosporangium phytohabitans
Brite
KEGG Orthology (KO) [BR:kphy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AOZ06_47840
Enzymes [BR:kphy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AOZ06_47840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N
Motif
Other DBs
NCBI-ProteinID: ALG13556
UniProt: A0A0N9IFD8
LinkDB All DBs
Position
10721121..10721534
Genome map
AA seq 137 aa AA seqDB search
MRLPSLRALVRPRLEASAHCDLPCGVYDPAQARIEAESIKAIQEKYQANEDLEFRARAVV
IKEQRSELVKHHLWVLWTDYFKAPHFEKYPQLHDLFNRATKAAGAAGTKGTMDPAKGQEL
LDLIAEIDKIFWETKQG
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgccgtcgctcagggcgctcgtgcgcccgcggctggaggcaagcgctcactgc
gacctgccatgcggggtctacgaccccgcccaggcccggatcgaagccgagtcgatcaag
gcgatccaggagaagtaccaggccaacgaggacctggagttccgcgcgcgtgcggtcgtg
atcaaggagcagcgcagcgaactggtcaagcaccacctgtgggtgctctggacggactac
ttcaaggcgccgcacttcgagaagtacccgcagctgcacgacctgttcaaccgcgcgacg
aaggcggccggagcagcggggacgaagggcaccatggacccggcgaagggccaggagctg
ctcgacctgatcgcggagatcgacaagatcttctgggagaccaagcagggctga

DBGET integrated database retrieval system