KEGG   Kibdelosporangium phytohabitans: AOZ06_48900Help
Entry
AOZ06_48900       CDS       T04088                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
kphy  Kibdelosporangium phytohabitans
Pathway
kphy00020  Citrate cycle (TCA cycle)
kphy00480  Glutathione metabolism
kphy01100  Metabolic pathways
kphy01110  Biosynthesis of secondary metabolites
kphy01120  Microbial metabolism in diverse environments
kphy01130  Biosynthesis of antibiotics
kphy01200  Carbon metabolism
kphy01210  2-Oxocarboxylic acid metabolism
kphy01230  Biosynthesis of amino acids
Module
kphy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kphy_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:kphy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AOZ06_48900
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AOZ06_48900
Enzymes [BR:kphy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AOZ06_48900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ALG13740
UniProt: A0A0N9IBD0
LinkDB All DBs
Position
complement(10937047..10938261)
Genome map
AA seq 404 aa AA seqDB search
MAKIKVQGTVVELDGDEMTRIIWQFIKDKLIHPYLDINLDYYDLGIEHRDATDDQVTVDA
ANAISRHGVGVKCATITPDEARVEEFGLKKMWLSPNGTIRNILGGVIFREPIVISNIPRL
VPGWTKPIIIGRHAHGDQYKAQNFKVPGAGELTITFTPEDGSEPIQHVIANYGPDGGVAL
GMFNFNKSIEDFARASLRYGLEREYPVYMSTKNTILKAYDGAFKDIFQRVYEEEFKADFD
AKGLTYEHRLIDDMVAAALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDG
KVEAEAAHGTVTRHYRQHQAGKPTSTNPIASIYAWTRGLDARAKQDSTPEVAGFANALEQ
VVVETVESGKMTKDLALLVGPDQAWQTTEEFLATLDENLQKKMA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatcaaggtccaggggacggtcgtcgaactcgacggcgacgagatgacccgc
atcatctggcagttcatcaaggacaagctgatccacccgtacctggacatcaacctggac
tactacgacctgggcatcgagcaccgggacgccaccgacgaccaggtcaccgtggacgcg
gcgaacgccatctcgcggcacggcgtcggcgtcaagtgcgccaccatcaccccggacgag
gcgcgggtcgaggagttcggcctcaagaagatgtggctgtcgcccaacggcacgatccgc
aacatcctcggcggcgtgatcttccgcgagccgatcgtcatctccaacatcccccggctg
gtccccggctggacgaagccgatcatcatcggccgccacgcccacggcgaccagtacaag
gcgcagaacttcaaggtccccggcgccggtgagctgaccatcacgttcacgccggaagac
ggctcggagccgatccagcacgtgatcgccaactacggccccgacggcggcgtcgcgctg
ggcatgttcaacttcaacaagtcgatcgaggacttcgcgcgcgcctcgctgcgctacggc
ctcgagcgcgagtacccggtgtacatgtccaccaagaacaccatcctcaaggcgtacgac
ggtgccttcaaggacatcttccagcgcgtctacgaggaggagttcaaggcggacttcgac
gccaagggcctgacctacgagcaccggctgatcgacgacatggtcgccgcggcgctgaag
tgggagggcggctacgtctgggcctgcaagaactacgacggtgacgtccagtccgacacc
gtggcgcagggcttcggctcgctcggcctgatgacctccgtgctgatgaccccggacggc
aaggtcgaggccgaggccgcgcacggcacggtcacccggcactaccgccagcaccaggcg
ggcaagccgacctcgaccaacccgatcgcgtcgatctacgcgtggacccggggcctggac
gcgcgtgccaagcaggacagcacccctgaggtggcgggcttcgcgaacgcgctggagcag
gtcgtcgtcgagaccgtcgagagcggcaagatgaccaaggacctggccctgctcgtcggc
cctgaccaggcatggcagaccaccgaggagttcctggccaccctggacgagaacctccag
aagaagatggcctga

DBGET integrated database retrieval system