KEGG   Kibdelosporangium phytohabitans: AOZ06_52895Help
Entry
AOZ06_52895       CDS       T04088                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
kphy  Kibdelosporangium phytohabitans
Pathway
kphy00473  D-Alanine metabolism
kphy00550  Peptidoglycan biosynthesis
kphy01100  Metabolic pathways
kphy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:kphy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AOZ06_52895
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AOZ06_52895
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AOZ06_52895
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kphy01011]
    AOZ06_52895
Enzymes [BR:kphy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AOZ06_52895
Peptidoglycan biosynthesis and degradation proteins [BR:kphy01011]
 Precursor biosynthesis
  Amino acid ligase
   AOZ06_52895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 RimK ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ALG14426
UniProt: A0A0N9IDE3
LinkDB All DBs
Position
11751278..11752225
Genome map
AA seq 315 aa AA seqDB search
MSDRTVAVLSGGLSHERDVSLRSGRRLSTALRAVGLTVDEWDTDGSLLTKVSTQKPDAVV
IALHGGEGENGSIQTVLEMLGVPFVGADSHACRRAWDKPTAKAELSRAGLLTPDWVVLPH
STFRELGAQAVLDAMVGRLGLPLMLKPDQGGSALGAQVVCDAADLPAAMVNCLAYGETVL
AERFISGVEVAVTVVDGADGPAALPAVEIVPESGVYDYTSRYTAGFTNFHTPARLSPKIA
GEVAELAVSAHRLLGLRDVSRTDAVVADDGSIYFLEVNVSPGLTETSLLPMASEADGRSL
GEIYAELVDRAIARS
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagatcgaactgttgccgtcctgtccggcgggctttcgcacgagcgtgatgtttcc
cttcggtcggggcggcgactgtcgactgccctgcgcgcggtcggcctgaccgtcgacgag
tgggacaccgacggctccctgctgacgaaggtcagcacccagaagccggacgcggtcgtg
atcgcgttgcacggcggtgaaggggagaacggctctatccagaccgtgctggagatgctc
ggcgtgccgttcgtcggcgcggactcgcacgcgtgccgccgcgcctgggacaagccgacc
gccaaggccgagttgtcccgtgccggactgctcaccccggactgggtcgtgctgccacac
agcacgttccgggagttgggcgcgcaggcggtgctcgacgcgatggtggggcgtttgggt
ctgccgctgatgctcaagccggaccagggcgggtcagcgctcggtgctcaggtcgtgtgc
gacgcggccgacctcccggccgcgatggtcaactgcctcgcgtacggcgagaccgtgttg
gccgagcggttcatctccggcgtcgaggtcgcggtgacggtcgtcgacggcgccgatggg
ccggccgctttgcccgcggtcgagatcgttcccgagagcggggtctacgactacacatcc
cggtacaccgcgggcttcacgaacttccacaccccggctcgcctgtcgccgaagatcgcg
ggcgaggtcgccgagttggctgtgtcggcgcaccggctgctcggtctgcgcgatgtgtca
cggaccgacgcggtggtcgccgacgacggctcgatctacttcctcgaagtgaacgtgtcg
cccgggttgaccgagacgtcgctcctgccgatggcgagcgaggcggacgggcggtcactc
ggggagatctacgccgaactcgtcgaccgcgccatcgcccggagctga

DBGET integrated database retrieval system