KEGG   Klebsiella pneumoniae CG43: D364_01320Help
Entry
D364_01320        CDS       T02866                                 

Definition
(GenBank) diaminohydroxyphosphoribosylaminopyrimidine deaminase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
kpi  Klebsiella pneumoniae CG43
Pathway
kpi00010  Glycolysis / Gluconeogenesis
kpi00020  Citrate cycle (TCA cycle)
kpi00620  Pyruvate metabolism
kpi01100  Metabolic pathways
kpi01110  Biosynthesis of secondary metabolites
kpi01120  Microbial metabolism in diverse environments
kpi01130  Biosynthesis of antibiotics
kpi01200  Carbon metabolism
Module
kpi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D364_01320
   00020 Citrate cycle (TCA cycle)
    D364_01320
   00620 Pyruvate metabolism
    D364_01320
Enzymes [BR:kpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     D364_01320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl SLD3
Motif
Other DBs
NCBI-ProteinID: AGX36538
LinkDB All DBs
Position
complement(290552..292087)
Genome map
AA seq 511 aa AA seqDB search
MSEIKTLEMPKWGLSMEEGLLARWAIQEGDDFTRGQEICEIETSKIVNVLEAPFAGTLRR
ILAREGETLQVGAVLALAADASVSDAELDEFVARLATAKPAAPGPEAAAPDVAAQAGAKP
ASVVSPPSNSPEPPVGQTVIPVSLQGVTDVTQVNATPHALRLSARWGVDLKKVRGSGRGD
RISVSDLESAIVAAGGRLASPTPPVRRSKAPRSHADDSQVSATPLARRLAGKLGINLHDC
RSSGSRGRVSRDDVLAAALLLDEHPQTSPVQESAPAPFESIPMSGMRRAIASRLQTSKQQ
SPHFRLSVDLDLERLLALRQDINREVPGVKISVNDLLVKACALALVAVPDVNIQFDEAAQ
SIRRFTDADISVAVALPAGLITPIVRSANRKSISDISNEIHSLVTRAKAGTLKPEEFQGG
TFSLSNLGMLGVRQFDAIINPPQSAILAIGAGEVRAVVRDGQIVARQQMTVSLSCDHRVI
DGAAGAAFLRELKRLIETPTLMFIQETSYAR
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaatcaagacgcttgaaatgccaaagtgggggctttccatggaggaaggcttg
ctcgctcgatgggcaatccaggagggtgacgatttcaccagagggcaggaaatatgtgag
attgaaaccagtaaaatcgtcaatgtgctggaggccccctttgccggtacgttacgtcgg
atactcgcccgcgagggtgagacgcttcaggtaggcgccgtgctggccctggcggctgac
gcgtcggtcagcgatgctgaactggacgaatttgttgcccgcctggcgacggcgaaaccc
gcagccccaggcccggaggctgccgcgccggacgtagcggcacaggcaggcgctaagcca
gcttccgttgtttcgccgccatccaacagccccgagccccctgttgggcagaccgtcatc
cccgtcagtctgcaaggtgtgaccgatgtgactcaggttaatgccacgccccatgcgtta
cgactgtctgcccgctggggtgtcgacctgaaaaaagtccgcggcagcgggcgcggggat
cgtatctctgtttctgatctggaaagcgcgatcgttgccgccggcggtcgcctggcctct
ccgacgccccccgttcgtcgcagcaaagcgccccgctcgcatgccgatgacagccaggta
tcggccaccccgctggcgcgccgcctggccggcaaactgggtatcaacttgcatgactgc
cgaagcagcggttcacgcggtcgggtaagtcgcgatgatgtgctggccgcggcgttgtta
ctcgacgagcacccgcagaccagtcctgtgcaggagagtgccccggccccctttgagagc
atcccgatgtccggtatgcggcgggctatcgcttctcgcctgcaaacgtccaagcaacag
tctccccatttccgtttgagcgtcgatctcgatctggagcgactgttagcgttacgtcag
gacattaaccgcgaagtacccggcgtcaagatttcggtgaatgacctgctggtgaaggcc
tgcgccctggcgctggtggccgtgcctgacgtcaatatccagtttgatgaagcggcacaa
agtatccgccgctttacggatgccgacatttcggtggccgttgcgctgcctgccgggcta
attacccctattgttcgctcggcgaaccggaaatcgattagcgacatatcgaacgaaatt
cactcgctggtgaccagagccaaagcgggcacgctgaagccggaagagttccagggcggg
acctttagcctgtcaaatctggggatgctcggcgtccggcagtttgacgccatcatcaat
ccaccgcaaagcgcaatcctcgccattggcgccggcgaggtccgggcggtagtacgcgac
gggcaaatcgtcgcgcgacagcaaatgacggtatcgctatcctgcgatcaccgggtcatc
gatggcgcggcaggtgcggcttttctccgggaactcaagcgactgattgaaaccccgacc
ttgatgtttatccaggagacgagctatgcacgataa

DBGET integrated database retrieval system