KEGG   Klebsiella pneumoniae CG43: D364_13870Help
Entry
D364_13870        CDS       T02866                                 

Gene name
fadJ
Definition
(GenBank) fatty-acid oxidation protein subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
kpi  Klebsiella pneumoniae CG43
Pathway
kpi00071  Fatty acid degradation
kpi00280  Valine, leucine and isoleucine degradation
kpi00281  Geraniol degradation
kpi00310  Lysine degradation
kpi00362  Benzoate degradation
kpi00380  Tryptophan metabolism
kpi00410  beta-Alanine metabolism
kpi00640  Propanoate metabolism
kpi00650  Butanoate metabolism
kpi00903  Limonene and pinene degradation
kpi00930  Caprolactam degradation
kpi01100  Metabolic pathways
kpi01110  Biosynthesis of secondary metabolites
kpi01120  Microbial metabolism in diverse environments
kpi01130  Biosynthesis of antibiotics
kpi01200  Carbon metabolism
kpi01212  Fatty acid metabolism
Module
kpi_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    D364_13870 (fadJ)
   00650 Butanoate metabolism
    D364_13870 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    D364_13870 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    D364_13870 (fadJ)
   00310 Lysine degradation
    D364_13870 (fadJ)
   00380 Tryptophan metabolism
    D364_13870 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    D364_13870 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    D364_13870 (fadJ)
   00281 Geraniol degradation
    D364_13870 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    D364_13870 (fadJ)
   00930 Caprolactam degradation
    D364_13870 (fadJ)
Enzymes [BR:kpi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     D364_13870 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     D364_13870 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     D364_13870 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AGX38820
LinkDB All DBs
Position
complement(2903543..2905687)
Genome map
AA seq 714 aa AA seqDB search
MDTVSAFKLEVRADKIAVITIDAPGEKMNTLKAEFGSQVRGLIRQLRDDKSVRGVVFISA
KADNFIAGADINMIARCRSAQEAEALARQGQQIMAEIHGLSIPVIAAIHGACLGGGLELA
LACHGRICSDDEKTRLGLPEVQLGLLPGSGGTQRLPRLIGVSTALDMMLTGKQLRPRQAL
KAGLVDEVVPQAILLQAAVELALKGRPTSREVPVRERVLAGPLGRHLLFQFVGKQTQRKT
QGNYPAVKRILQVVENGLAHGCSSGYAEEARAFGELAMSPQSQALRSIFFASTDLKKDPG
AEAGPGPLRSVAVLGGGLMGGGIAYVTACKGGLPVRIKDIQPRGINHALKYSWDLLNKQV
RQRRLRPVERDRQMALISGTTDYQGFAHRDVVIEAVFEDLALKQRMVSEVEQYGGPQTIF
ASNTSSLPIGDIAAHASRPGQVIGLHFFSPVEKMPLVEVIPHKGTDPQTIATVVQLAKRQ
GKTPIVVADKAGFYVNRILAPYINEAMRLLVEGEPIEVIDNALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEGAFGERFSPPANIIDAILKDDRKGRKNNRGFYLYETKGRKSKKRPDPA
VYPLLGIGRPQSRLSAQQVAERCVMMMLNEAARCFDEQIIRSARDGDIGAVFGIGFPPFL
GGPFRYMDTIGAGEVAAILQRLAAQFGPRFTPCDTLLRMAEQGTTFWPADERLT
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggatactgtttccgcttttaagcttgaggtccgtgcggacaaaatcgcggtgatcacc
attgatgccccgggtgaaaaaatgaataccctgaaagccgaatttggcagtcaggtacgg
ggattgatacgccagttacgtgacgataagtcagtgcgcggcgtagtatttatctccgcc
aaagcggataactttatcgccggcgctgatatcaacatgattgcccgctgccgcagcgcg
caggaggcggaagcgctggcgcgccagggacagcagattatggctgagatccatggcctg
tcgatcccggtgattgccgctatccacggcgcctgccttggcggcggtctggagctggcg
ctggcctgtcatggccgtatctgtagcgatgacgaaaaaacccgactcggcttgccggag
gtacagcttggcctgctgccgggttccggcgggacgcagcgtttaccgcggctgatcggg
gtaagcaccgcgctggatatgatgctcaccggcaagcagctgcggccgcggcaggcgctg
aaggccggtctggtggacgaggtggtgccgcaggcgattttactgcaggcggcggtggag
ttggcgctgaagggacgaccgaccagccgggaggtgcctgttcgtgaacgcgtactggca
gggcccctggggcgccatctgttattccagtttgtcggtaaacaaacgcagcgcaaaacg
cagggaaattacccggcggtgaagcgaatcttgcaggtcgtcgagaatggtctggcccat
ggctgcagcagcggatacgctgaagaggcgcgcgcatttggcgaactggcgatgagcccg
cagtcgcaggcgctgcgatcgatcttctttgccagtaccgatctgaaaaaagaccctggc
gccgaggcgggccccggtccgctgagaagcgttgcagtactgggcggtggcttgatgggc
ggggggatcgcctatgtgaccgcctgtaagggtgggctgccggtgcggattaaagatatc
cagccgcgtggcatcaaccacgccttaaagtacagctgggatctgctgaataaacaggtt
cgtcagcgtcgactgcgcccagtggagcgcgatcgtcagatggcgctgatctccggcact
accgactatcagggctttgctcatcgcgatgtggtgatcgaggcggtatttgaagacctg
gctctcaaacagcggatggtcagcgaagtggaacaatacggcgggccgcagaccatcttt
gcgtcgaatacctcatcgttgccaatcggcgatattgccgctcacgccagccgcccgggg
caggtaatcggcctgcattttttcagtccggtggaaaaaatgccgctggttgaggtgatc
ccgcacaagggaaccgacccgcagactatcgccaccgtggtgcagctggctaaacggcag
gggaaaacgccgattgttgtcgcagataaagcggggttctatgtgaaccgtatcctcgcg
ccgtatatcaatgaagcgatgcgcctgctggtggaaggcgaaccgattgaagtcattgat
aacgcgttggttaaattcggtttcccggtggggccgattcaactgctggatgaggtgggt
atcgataccggcaccaaaattattcccgtgctggagggcgcgtttggagaacgttttagc
ccgcctgcaaacatcattgacgcgattttgaaggacgatcgcaaaggcagaaaaaataat
cgtggtttctatctttatgagacaaaagggcgtaaaagcaaaaaacggcccgacccggca
gtctatccgctgctcggcatcggccgcccgcagtcgcggctctccgcgcagcaggtggcg
gagcgctgtgtgatgatgatgcttaacgaagcggcgcgctgctttgatgagcagattatc
cggagcgcgcgcgatggcgatatcggcgccgtctttggtatagggtttccgccatttctt
ggcggcccgttccggtatatggatactatcggcgcgggtgaagttgccgcgatcctgcag
cgcctggccgcccagttcggcccacgttttacaccctgtgacactttattacgcatggct
gaacaggggaccaccttttggccagcggatgaacggctgacctaa

DBGET integrated database retrieval system