KEGG   Klebsiella pneumoniae CG43: D364_17980Help
Entry
D364_17980        CDS       T02866                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00086  1,3-propanediol dehydrogenase [EC:1.1.1.202]
Organism
kpi  Klebsiella pneumoniae CG43
Pathway
kpi00561  Glycerolipid metabolism
kpi00640  Propanoate metabolism
kpi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    D364_17980
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    D364_17980
Enzymes [BR:kpi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.202  1,3-propanediol dehydrogenase
     D364_17980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Hydrolase Lamprin
Motif
Other DBs
NCBI-ProteinID: AGX39506
LinkDB All DBs
Structure
PDB: 

Position
3745720..3746883
Genome map
AA seq 387 aa AA seqDB search
MSYRMFDYLVPNVNFFGPNAISVVGERCQLLGGKKALLVTDKGLRAIKDGAVDKTLHYLR
EAGIEVAIFDGVEPNPKDTNVRDGLAVFRREQCDIIVTVGGGSPHDCGKGIGIAATHEGD
LYQYAGIETLTNPLPPIVAVNTTAGTASEVTRHCVLTNTETKVKFVIVSWRNLPSVSIND
PLLMIGKPAALTAATGMDALTHAVEAYISKDANPVTDAAAMQAIRLIARNLRQAVALGSN
LQARENMAYASLLAGMAFNNANLGYVHAMAHQLGGLYDMPHGVANAVLLPHVARYNLIAN
PEKFADIAELMGENITGLSTLDAAEKAIAAITRLSMDIGIPQHLRDLGVKEADFPYMAEM
ALKDGNAFSNPRKGNEQEIAAIFRQAF
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgagctatcgtatgtttgattatctggtgccaaacgttaacttttttggccccaacgcc
atttccgtagtcggcgaacgctgccagctgctgggggggaaaaaagccctgctggtcacc
gacaaaggcctgcgggcaattaaagatggcgcggtggacaaaaccctgcattatctgcgg
gaggccgggatcgaggtggcgatctttgacggcgtcgagccgaacccgaaagacaccaac
gtgcgcgacggcctcgctgtgtttcgccgcgaacagtgcgacatcatcgtcaccgtgggc
ggcggcagcccgcacgattgcggcaaaggcatcggcatcgccgccacccatgagggcgat
ctgtaccagtatgccggaatcgagaccctgaccaacccgctgccgcctatcgtcgcggtc
aataccaccgccggcaccgccagcgaggtcacccgccactgcgtcctgaccaacaccgaa
accaaagtgaagtttgtgatcgtcagctggcgcaacctgccgtcggtctctatcaacgat
ccgctgctgatgatcggtaaaccggccgccctgaccgcggcgaccgggatggatgccctg
acccacgccgtagaggcctatatctccaaagacgctaacccggtgacggacgccgccgcc
atgcaggcgatccgcctcatcgcccgcaacctgcgccaggccgtggccctcggcagcaat
ctgcaggcgcgggaaaacatggcctatgcctctctgctggccgggatggctttcaataac
gccaacctcggctacgtgcatgccatggcgcaccagctgggcggcctgtacgacatgccg
cacggcgtggccaacgctgtcctgctgccgcatgtggcgcgctacaacctgatcgccaac
ccggagaaattcgccgatatcgctgaactgatgggcgaaaatatcaccggactgtccact
ctcgacgcggcggaaaaagccatcgccgctatcacgcgtctgtcgatggatatcggtatt
ccgcagcatctgcgcgatctgggggtaaaagaggccgacttcccctacatggcggagatg
gctctgaaagacggcaatgcgttctcgaacccgcgtaaaggcaacgagcaggagattgcc
gcgattttccgccaggcattctga

DBGET integrated database retrieval system