KEGG   Klebsiella pneumoniae JM45: N559_1679Help
Entry
N559_1679         CDS       T02799                                 

Definition
(GenBank) putative phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
kpj  Klebsiella pneumoniae JM45
Pathway
kpj00010  Glycolysis / Gluconeogenesis
kpj00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:kpj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    N559_1679
   00500 Starch and sucrose metabolism
    N559_1679
Enzymes [BR:kpj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     N559_1679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AGT23423
LinkDB All DBs
Position
1712405..1713799
Genome map
AA seq 464 aa AA seqDB search
MKTFPADFLWGGATAANQVEGAYLEDGKGLSTSDVQPHGVFGEVVERVPGDSGIKDVAID
FYHRYPEDIALFAEMGFNCLRVSIAWTRIYPNGDDAEPNEAGLAFYDKLFDEMAKHSITP
LVTLSHYEMPWALVKNYGGWGSREVIGFFERYARTVFSRYKNKVKLWLTFNEINMSLHAP
MTGVGLPAGSSKGEVYQAIHHQLVASALAVKACHELVPEGKIGNMLLGGLMYPLSCKPED
VFETLQENRSWQFFGDVQARGAYPGYMQRYFRDNGITLTITDADREALKTTVDFISFSYY
MTGCVTADEALNQQARGNILSMVPNPHLASSEWGWQIDPLGLRTLLNVLWDRYQKPLFIV
ENGLGAKDKVEADGSINDDYRISYLNDHLVQAREAIDDGVELMGFTSWGPIDLVSASKAE
LSKRYGFIYVDRHDDGTGTLARSKKKSFGWYKEVIASRGASLKA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattcccggcggattttttgtggggcggcgcgactgcggccaatcaggtggaa
ggtgcttatctggaagatggcaaaggcttatccacctccgatgtgcagccgcatggcgtg
ttcggcgaagtggtcgagcgtgtacccggcgacagcggcataaaagatgtggcgatcgat
ttttaccatcgctatccggaagatatcgccctgtttgccgagatgggttttaactgcctg
cgagtctccatcgcctggacccgcatctaccccaacggcgacgacgccgagccgaacgaa
gccggcctcgcgttctacgacaagctgttcgacgagatggcgaagcacagcatcaccccg
ctggtgacgctgtcgcattatgaaatgccatgggcgctggtaaaaaactacggcggctgg
ggcagccgggaggtgattggcttctttgagcgctacgcccggacggtgttcagccgctat
aaaaataaggtcaaactgtggctgacctttaacgaaatcaatatgtcgctgcatgccccg
atgaccggcgtcggcctgccggccggcagcagcaaaggcgaggtgtatcaggcgattcac
caccagctggtggccagcgcgctggcggtcaaagcctgtcatgagctggtgcctgagggc
aaaatcggcaatatgctgctcggcgggctgatgtatcccctgagctgcaaaccggaggat
gtgttcgagacgctgcaggagaaccgcagctggcagttcttcggcgacgtacaggcgcgc
ggcgcgtacccgggctatatgcagcgctatttccgtgacaacggcatcacgctcaccatc
accgacgccgatcgtgaagcgctaaaaaccaccgtcgactttatctccttcagctactac
atgaccggctgcgtcaccgccgacgaggcgctgaaccagcaggcgcgcggcaatattctc
agcatggtgccgaacccgcacctggcgagctcggagtggggctggcagatagatccgctg
ggcctgcgcacactgctgaacgtgctgtgggatcgctaccagaagccgctgtttatcgtg
gaaaacggtctgggcgccaaagataaggtggaagccgacggcagcattaacgatgactac
cgcatcagttacctgaacgaccacctggtgcaggcgcgggaagccattgacgatggcgtt
gagctgatgggctttaccagctggggaccgattgacctggtgagcgcctcaaaggcggag
ctgtcgaagcgctacggctttatctatgtcgaccgccatgatgacggtaccggcaccctg
gcgcgcagtaagaagaagagctttggctggtataaagaggtgattgccagccgcggcgcc
agcctgaaagcctaa

DBGET integrated database retrieval system