KEGG   Klebsiella pneumoniae JM45: N559_1840Help
Entry
N559_1840         CDS       T02799                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
kpj  Klebsiella pneumoniae JM45
Pathway
kpj00500  Starch and sucrose metabolism
kpj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    N559_1840
Enzymes [BR:kpj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     N559_1840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AGT23573
LinkDB All DBs
Position
complement(1892971..1894515)
Genome map
AA seq 514 aa AA seqDB search
MLDISHTAKVSLLTSGAWKMKNPTLLQCFHWYYPTGGELWPEVEALAPSLNEIGINMVWL
PPAYKGASGGYSVGYDTYDLFDLGEFDQKGSVATKYGDKAQLLAAINALKEHNIAVLLDV
VVNHKMGADEKESLRVQRVDEQDRTQIDEEIIECEAWTRYTFPVRAGQYSQFVWDYKCFS
GIDHIENPTEDGVFKIVNDYTGEGWNEQVDDELGNFDYLMGANIDFRNHAVTEEIKYWAR
WVMEQTGCDGFRLDAVKHIPAWFYKAWIEHVQEVAPQPLFIVAEYWSHEVEKLQQYIDLV
EGKTMLFDAPLQMKFHEASRQGRDYDMSQIFSGTLVEADPFHAVTLVTNHDTQPLQALEA
PVEPWFKPLAYALILLRENGVPSVFYADLFGASYEDTGGDGETYAIEMPVIEQLHELIDA
RQRFAHGVQTLWFDHPNCIAFSRSGTDDDPGCVVIMSNGDEGEKTLTLGENYGNKRWRDF
LGNREEIVETDGEGYATFTCNGGSVSVWVLEEVL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
ttgctggatatctcccatactgcaaaggtcagcctgttgacgtctggagcatggaagatg
aaaaaccccaccttattgcaatgttttcactggtactaccccaccggcggcgagctgtgg
cctgaggtcgaagcgctggcgcccagcctgaatgaaatcggcatcaatatggtctggttg
ccacccgcctacaaaggcgcctcgggcggttactccgtcggctatgatacctacgatctc
tttgacctcggcgagtttgatcaaaaagggtctgtcgccaccaaatatggcgacaaagcg
cagttgctggcggcgatcaacgccctgaaggagcacaatatcgccgtgctgctggatgtg
gtggtcaaccataaaatgggcgctgatgaaaaagagtctctgcgcgttcagcgcgtcgat
gagcaggatcgtacgcaaattgacgaggagatcattgagtgcgaggcatggacgcgctac
accttcccggtgcgcgccggacagtattcgcagtttgtctgggactacaaatgttttagc
ggcattgaccacatcgagaacccgacggaagacggtgtgtttaaaatcgtcaacgattac
accggcgaaggctggaatgaacaggtcgatgatgagctcggcaactttgactatctgatg
ggcgccaatatcgatttccgcaatcatgcagtgaccgaggagatcaaatactgggcgcgc
tgggtaatggagcagaccggctgcgacggttttcgtcttgacgcggtcaagcatatcccc
gcctggttttataaagcgtggatcgagcatgttcaggaggtggccccgcagccgctgttt
attgtagcggaatactggtcccatgaagtggagaagctccagcagtatatcgacctggtc
gagggcaaaacgatgctgtttgatgccccactgcagatgaaatttcatgaagcgtcgcgc
cagggccgcgattatgacatgagccagattttcagcgggacgctggtggaagccgaccct
ttccatgccgtcactctggtcaccaatcatgatacgcagccgctgcaggccctcgaggcg
ccggttgaaccctggttcaagcccctcgcctatgcgctgatcctgctgcgggagaatggc
gtgccctcggtcttttatgccgacctcttcggcgcttcctatgaggataccggcggcgac
ggagagacatatgccattgagatgcccgttatcgaacaactccacgagctgatcgacgct
cgtcagcgttttgcccatggcgtgcaaactctttggttcgatcatcctaactgcatcgcc
tttagtcgtagcggtactgacgacgatccaggctgcgtggtgatcatgtccaatggcgat
gagggcgaaaagacgctgacgctgggcgaaaactatggcaacaaacgctggcgggatttt
ctcggtaaccgggaagagattgtcgaaaccgatggcgaaggctacgcgacctttacatgt
aacggggggagcgtgagcgtgtgggtgttagaggaggtattgtag

DBGET integrated database retrieval system