KEGG   Klebsiella pneumoniae JM45: N559_3593Help
Entry
N559_3593         CDS       T02799                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
kpj  Klebsiella pneumoniae JM45
Pathway
kpj00020  Citrate cycle (TCA cycle)
kpj00190  Oxidative phosphorylation
kpj00650  Butanoate metabolism
kpj01100  Metabolic pathways
kpj01110  Biosynthesis of secondary metabolites
kpj01120  Microbial metabolism in diverse environments
kpj01130  Biosynthesis of antibiotics
kpj01200  Carbon metabolism
Module
kpj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
kpj_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:kpj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    N559_3593
   00650 Butanoate metabolism
    N559_3593
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    N559_3593
Enzymes [BR:kpj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     N559_3593
    1.3.5.4  fumarate reductase (quinol)
     N559_3593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AGT25240
LinkDB All DBs
Position
complement(3652917..3653633)
Genome map
AA seq 238 aa AA seqDB search
MKLEFSIYRYNPDVDDAPHMQDYTLEAEEGRDMMLLDALIQLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETSERLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgagttttcaatttatcgctataacccggatgttgacgacgctccgcacatg
caggattacacccttgaagcggaagaaggtcgcgacatgatgctgctggatgcgctgatc
cagctgaaagaaaaagatccgtcgctgtcgttccgccgctcctgccgtgaaggggtctgc
gggtccgatggtctgaacatgaacgggaaaaacggtttggcgtgcatcacgccaatctcc
gcgctgaatcagccgggcaagaagattgttatccgtccgctgccaggattaccggttatc
cgtgatttggtggtggacatggggcaattctatgcacaatatgagaagattaagccttac
ttgttgaataatgggcaaaatcctccggctcgcgagcatctgcagatgcctgagcagcgt
gagaaactcgacgggctgtacgagtgtattctgtgcgcctgctgttcgacctcgtgcccg
tcgttctggtggaacccggacaagttcatcggcccggctggcctgctggccgcgtatcgc
ttcctgatcgacagtcgcgataccgaaaccagcgagcgcctggacggcctgagcgatgct
ttcagcgtattccgctgtcacagcattatgaactgcgtcagtgtgtgtccgaaggggctg
aacccgacgcgcgccatcggccatattaagtcgatgctgctgcagcgcagcgcgtaa

DBGET integrated database retrieval system