KEGG   Klebsiella pneumoniae JM45: N559_3595Help
Entry
N559_3595         CDS       T02799                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
kpj  Klebsiella pneumoniae JM45
Pathway
kpj00020  Citrate cycle (TCA cycle)
kpj00190  Oxidative phosphorylation
kpj00650  Butanoate metabolism
kpj01100  Metabolic pathways
kpj01110  Biosynthesis of secondary metabolites
kpj01120  Microbial metabolism in diverse environments
kpj01130  Biosynthesis of antibiotics
kpj01200  Carbon metabolism
Module
kpj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
kpj_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:kpj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    N559_3595
   00650 Butanoate metabolism
    N559_3595
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    N559_3595
Enzymes [BR:kpj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     N559_3595
    1.3.5.4  fumarate reductase (quinol)
     N559_3595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C
Motif
Other DBs
NCBI-ProteinID: AGT25241
LinkDB All DBs
Position
complement(3653649..3655301)
Genome map
AA seq 550 aa AA seqDB search
MFPTRSHTVSAQGGITVALGNSHEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILE
LEHMGLPFSRLDDGRIYQRPFGGQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHT
TIFSEWYALDLVKNQDGAVVGCTALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHIN
TGDGVGMAIRAGVPVQDMEMWQFHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAP
NAKDLAGRDVVARSIMIEIREGRGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFA
HVDPVKEPIPVIPTCHYMMGGIPTKVTGQALTVNEKGEDVVIPGLFAVGEIACVSVHGAN
RLGGNSLLDLVVFGRAAGLHLQESIAEQGTLRDASESDIEGSLDRLNRWNNTRSGEDPVA
IRKALQECMQHNFSVFREGDAMHKGLEQLKVIRERLKNARIDDTSSEFNTQRVECLELDN
LMETAYATAVSANFRTESRGAHSRFDFPDRDDENWLCHSLYLPESESMTRRSVNMEPKLR
PAFPPKIRTY
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
gtgttccctacccgttcccataccgtatccgcgcagggtggcatcaccgtcgcgctcggt
aactcccatgaagataactgggaatggcatatgtacgacaccgtaaaagggtcggactat
atcggcgaccaggacgccatcgaatacatgtgtaagaccggcccggaagcgattcttgag
ctggagcacatgggactgccgttctctcgtcttgacgatggccgtatttatcagcgcccg
tttggcggccagtcgaagaacttcggcggcgaacaggcggcgcgtaccgcggcggcggct
gaccgtaccggtcacgccctgctgcacactctgtatcagcagaacctgaaaaaccacacc
actatcttctccgaatggtacgccctcgatctggtgaaaaaccaggacggcgcggtagtc
ggttgtaccgccctgtgcatcgagaccggcgaagtggtctactttaaagcccgcgccacc
gtgctggcgaccggcggcgcaggccgtatctatcagtccaccaccaacgcccacatcaat
acgggtgacggcgtcgggatggccatccgcgccggcgtgccggtgcaggatatggaaatg
tggcagttccacccgaccggtatcgccggggctggggttctggttaccgaaggttgccgc
ggcgaaggcggttacctgctgaacaaacacggcgaacgctttatggagcgttatgccccg
aacgctaaagacctggcgggccgtgacgtggtggcgcgttccatcatgatcgaaatccgc
gaaggccgcggttgcgacggtccgtggggcccgcacgcgaaactgaaactggatcacctc
ggtaaagaggttctggaatctcgtctgccgggtatccttgaactttcccgtacctttgcc
cacgtcgatccggtgaaagagccgatcccggttatcccaacctgtcactacatgatgggc
ggtatcccgaccaaagtcaccggccaggcgttgaccgtgaatgagaagggcgaagacgtg
gtgatcccgggcctgttcgcggtaggcgaaatcgcctgcgtatcggtccacggcgccaac
cgtctgggcggcaactcgctgctcgacctggtggtcttcggccgcgcggcgggcctgcat
ctgcaggaatccattgccgagcagggcacgctgcgcgacgccagcgaatccgatatcgaa
ggctcgctggatcgcctcaaccgctggaacaacacccgctctggtgaagatccggtggcg
attcgtaaagcgctgcaggaatgtatgcagcataacttctcggtgttccgcgaaggcgat
gcgatgcacaaaggtctggagcaactgaaagtgatccgcgagcgcctgaaaaacgcccgt
atcgacgatacctccagcgagttcaacacccagcgcgttgagtgcctggagctggataac
ctgatggaaaccgcctacgcgaccgccgtatccgctaacttccgtaccgagagccgtggc
gcccacagccgcttcgacttcccggatcgtgatgatgaaaactggctgtgccattccctg
tacctgccagagtcggaatccatgacgcgtcgtagcgtcaatatggaaccgaaactgcgt
ccggcattcccgccgaagattcgtacttactaa

DBGET integrated database retrieval system