KEGG   Klebsiella pneumoniae JM45: N559_4089Help
Entry
N559_4089         CDS       T02799                                 

Definition
(GenBank) D-alanylalanine synthetase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
kpj  Klebsiella pneumoniae JM45
Pathway
kpj00473  D-Alanine metabolism
kpj00550  Peptidoglycan biosynthesis
kpj01100  Metabolic pathways
kpj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:kpj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    N559_4089
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    N559_4089
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    N559_4089
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:kpj01011]
    N559_4089
Enzymes [BR:kpj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     N559_4089
Peptidoglycan biosynthesis and degradation proteins [BR:kpj01011]
 Precursor biosynthesis
  Amino acid ligase
   N559_4089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: AGT25715
LinkDB All DBs
Position
4157649..4158779
Genome map
AA seq 376 aa AA seqDB search
MPFDVIWMEVEMAKMRVGIVFGGKSAEHEVSLQSAKNIVEAIDKSRFDVVLLGIDKQGLW
HINDAGNYLLNAQDPARIALRPSTVTLAQIPGREAQQLINAESGQPLAAIDVIFPIVHGT
LGEDGSLQGMLRMANLPFVGSDVLGSAACMDKDVTKRLLRDAGLAVAPFITLTRANRAQF
SFADVEAKLGLPLFVKPANQGSSVGVSKVKNEEQYHQAVALAFEFDHKVVVEQGIKGREI
ECAVLGNDHPQASTCGEIVLNSEFYAYDTKYIDDQGAQVVVPAAIAPEINDKIRAIAVQA
YQTLGCSGMARVDVFLTADNEVVINEINTLPGFTNISMYPKLWQASGLDYTSLITRLIEL
ALERHAADRALKTSMN
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgccctttgatgttatctggatggaagttgaaatggcaaagatgagggttgggatcgtt
tttggcggcaagtcggcggagcatgaagtgtcgctgcagtcagcgaagaatatcgtggaa
gcgattgataaatcgcgcttcgatgtggttctgttgggtattgataaacaggggctgtgg
catatcaacgacgccggcaactacctgctcaacgcacaggatcctgcccgcattgccctg
cgcccttccacggtgactctggcgcagatcccgggccgcgaagcgcagcagctgattaac
gccgaaagcggccaaccgctggcggccatcgatgtgattttcccgatcgtccacggcacg
ctgggtgaagatggctccctgcaggggatgctgcgcatggcgaatctgccgttcgtcggc
tccgatgtgctgggctctgcggcctgtatggacaaagacgtgaccaaacgtctgctgcgc
gacgccgggctcgccgtcgccccgtttatcacactcacccgcgccaaccgcgcgcagttc
agctttgccgatgtcgaagcgaagcttggcctgccgctgttcgttaagccggctaatcag
ggctcgtcggttggcgtcagcaaagttaaaaacgaagagcagtaccatcaggcggtggcc
ctggccttcgaatttgaccataaagtggtggtggagcaaggcattaaagggcgggaaatt
gagtgtgcggtgctgggtaacgaccacccgcaggccagcacctgcggtgaaatcgtcctc
aacagcgagttttacgcctacgacaccaagtatatcgacgatcagggcgcacaggtggta
gtcccggccgctatcgcccctgagatcaacgacaaaattcgcgctatcgcggtgcaggcc
taccagaccctgggctgcagcggcatggctcgtgtcgacgtgttcctcaccgccgacaac
gaggtggtgatcaacgagatcaacaccctgccgggctttaccaacatcagcatgtatccg
aagctgtggcaggccagcggtctcgactacaccagcctgatcacccgcctgattgagctg
gcgttggagcgccatgccgcggaccgggcgctgaaaacctccatgaactaa

DBGET integrated database retrieval system