KEGG   Klebsiella pneumoniae JM45: N559_5034Help
Entry
N559_5034         CDS       T02799                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
kpj  Klebsiella pneumoniae JM45
Pathway
kpj00620  Pyruvate metabolism
kpj00680  Methane metabolism
kpj01100  Metabolic pathways
kpj01120  Microbial metabolism in diverse environments
kpj01200  Carbon metabolism
Module
kpj_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:kpj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    N559_5034
  Energy metabolism
   00680 Methane metabolism
    N559_5034
Enzymes [BR:kpj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     N559_5034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AGT26611
LinkDB All DBs
Position
5166629..5169280
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGDTIKDALGENILDRVETIRKLSKSSRAGNEANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPNGEAASNPEVIARTLRKLKDQPNLNEE
TIKKAVESLSLELVLTAHPTEITRRTLIHKMVEVNNCLKQLDNKDIADYEHHQLMRRLRQ
LIAQSWHTDEIRKHRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEANLGYQLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDVQVLISELSMVECTDELR
ALAGAEGAQEPYRYLMKKLRSQLMETQAWLEARLKGQKLPKPAGLITQNEQLWEPLYACY
KSLQACGMGIIANGELLDTLRRVKSFGVPLVRIDIRQESTRHTEALGEMTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRQWEPSEETREVLDTCKVIAEAPRGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFALPVAPLFETLDDLNNANDVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTSAILEANLLPPPEPKAEWRDIMAEL
SDVSCKMYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVEGGKQSELEAMCRDWPFFSTRLGMLEMVYSKADLWLAE
YYDQRLVKPELWALGSELRKLLAADINVVLAIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRQAEEEGKDPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcattgcgtagtaatgtcagtatgctcggcaaggtgctgggc
gataccatcaaggatgcattgggagaaaatattcttgatcgtgtcgaaactatccgtaag
ttgtccaaatcttcacgcgccggcaacgaagctaaccgccaggagctgctgaccacgctg
cagaatttgtctaacgacgaactgctgccggtagcccgtgccttcagccagttcctgaat
ctggctaacaccgctgagcagtaccacagcatttcgccgaatggcgaagcggccagcaat
ccggaagtcattgcgcgtaccctgagaaagctcaaagaccaacccaatctcaacgaagag
accatcaaaaaagcggtggaatctctgtccctggagctggtgttaaccgcccacccgacc
gagatcacccgccggacgctgatccataaaatggtggaagtgaacaactgcctcaagcag
ctggataacaaagatatcgcggactacgagcaccaccagctgatgcgccgtctgcgccag
ctgatcgcccagtcctggcataccgatgaaattcgtaagcaccgcccttccccggtcgat
gaagccaaatggggcttcgcggtggtggaaaacagcctgtgggaaggggtgcctaactac
ctgcgcgagctgaacgaacagctggaagccaacctcggctatcagctgccggtggacttt
gtcccggtgcgtttcacttcgtggatgggcggcgaccgcgacggcaacccgaacgtgacc
gccgatatcacccgccacgtgctgctgctcagccgctggaaagcgaccgacctgttcctc
aaagacgtgcaggtgctgatctccgagctgtcgatggtggagtgtaccgacgagctgcgc
gccctggctggcgccgagggcgctcaggaaccgtaccgttatctgatgaaaaaactgcgc
tctcagctgatggagacccaggcctggctggaagcgcgcctgaaaggccagaagctgccg
aaaccggcgggactgatcactcagaacgagcagctgtgggagccgctgtacgcctgctat
aaatcgctgcaggcctgcggcatgggcattatcgccaacggcgagctgctcgacaccctg
cgccgcgtgaagtctttcggcgtaccgctggtccgtattgatattcgtcaggaaagcacc
cgccataccgaagcgctgggtgaaatgacccgttacctcgggatcggcgactacgaaagc
tggtcggaagccgacaaacaggctttcctgatccgcgaactgaattccaaacgtccgctg
ctgccgcgccagtgggagccaagcgaagagacgcgtgaagttctcgacacctgcaaggtg
atcgccgaggcgccgcgcggatcgatcgctgcctacgtgatctcgatggcgaaaacgccg
tccgatgtgctggcggttcatctcctgctgaaagaagccgggattggctttgctctgccg
gtggccccgctgttcgaaacgctggatgacctcaacaacgccaacgacgtcatgacccag
ctgctgaatatcgactggtaccgcggctttatccagggcaagcagatggtcatgatcggc
tactctgactccgctaaagatgccggcgtgatggccgcctcctgggcgcagtaccaggcg
caggacgcgctgatcaaaacctgcgaaaaagccggtattgaactgacgctgttccacggt
cgcggcggctctatcggccgcggcggcgcgccggcccacgccgcgctgctctcgcagccg
ccgggaagcctgaaaggcggcctgcgcgttaccgagcagggcgagatgatccgctttaag
tacggcctgccggaagtcaccatcagcagcctgtcgctgtataccagcgccattctggaa
gccaacctgctgccgccgccggagccgaaagcagaatggcgcgacatcatggccgagctg
tccgacgtgtcgtgcaagatgtatcgcggctacgtgcgtgaaaacaaagatttcgtccct
tacttccgctctgcgaccccggagcaggagctgggcaaactgccgctgggttcgcgtccg
gcaaaacgtcgtccaaccggcggcgtcgagtcgctgcgcgccattccgtggatcttcgcc
tggacccagaaccgcctgatgctgccggcctggctgggcgctggcgctgcgctgcagaag
gtggtcgaaggtggaaaacagagtgaactggaagccatgtgtcgcgactggccgttcttc
tctacccgcctcggcatgctggagatggtttactcgaaggccgacctgtggctggcggag
tactacgatcagcgcctggtgaagccggagctgtgggcgctgggttccgagctgcgcaag
ctgctggctgccgatatcaacgtcgtgctggccatcgccaacgactcccatctgatggcc
gacctgccgtggatcgccgagtctatccagctgcgtaatatctataccgacccgctgaac
gtcctgcaggcggaactgctgcaccgttcacgccaggctgaagaagagggcaaggacccg
gatccgcgcgttgaacaagcgctgatggtcaccatcgccggcgtcgccgccggtatgcgt
aacaccggttaa

DBGET integrated database retrieval system