KEGG   Klebsiella pneumoniae JM45: N559_5062Help
Entry
N559_5062         CDS       T02799                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
kpj  Klebsiella pneumoniae JM45
Brite
Enzymes [BR:kpj01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     N559_5062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Spore_YpjB
Motif
Other DBs
NCBI-ProteinID: AGT26639
LinkDB All DBs
Position
complement(5197965..5198597)
Genome map
AA seq 210 aa AA seqDB search
MEMIMSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLSAEE
LITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKTGTTLQGDLKAAIERDFGSVENFKAE
FEKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIIGLDVWEHAYYL
KFQNRRPDYIKAFWDVVNWDEAAARFAAKK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggagatgattatgagctataccctgccatccctgccttacgcttacgatgctctggaa
ccgcacttcgacaagcagacgatggagatccatcacactaaacaccaccagacctacgtg
aacaatgccaacgccgcgctggaaagcctgccggagttcgctaacctgtccgctgaagag
ctgattaccaagctggatcagctgccggctgacaaaaaaaccgtactgcgtaacaacgcc
ggcggccacgcgaaccacagcctgttctggaaaggcctgaaaaccggtaccaccctgcag
ggcgacctgaaagcggctatcgagcgcgatttcggttccgtggagaacttcaaagcggaa
ttcgaaaaagccgctgctacccgtttcggctccggctgggcgtggctggtcctgaaaggt
gataaactggccgttgtctccaccgccaaccaggattccccgctgatgggcgaagccatt
tccggcgcttccggcttcccgattatcggcctggacgtctgggaacacgcttactacctg
aaattccagaaccgccgcccggactacatcaaagccttctgggacgtagtgaactgggac
gaagctgcagcgcgttttgccgccaaaaaataa

DBGET integrated database retrieval system