KEGG   Klebsiella variicola KP5-1: A593_09330Help
Entry
A593_09330        CDS       T03368                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kpk  Klebsiella variicola KP5-1
Pathway
kpk00250  Alanine, aspartate and glutamate metabolism
kpk00410  beta-Alanine metabolism
kpk00640  Propanoate metabolism
kpk00650  Butanoate metabolism
kpk01100  Metabolic pathways
kpk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A593_09330
   00650 Butanoate metabolism
    A593_09330
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A593_09330
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A593_09330
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kpk01007]
    A593_09330
Enzymes [BR:kpk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A593_09330
Amino acid related enzymes [BR:kpk01007]
 Aminotransferase (transaminase)
  Class III
   A593_09330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIE00736
LinkDB All DBs
Position
complement(1890264..1891529)
Genome map
AA seq 421 aa AA seqDB search
MKSSELNQRRQQATPRGVGVMCNYFVEKAENATLWDIEGNEVIDFAAGIAVLNTGHRHPK
VVAAVADQLQAFTHTAYQIVPYESYVSLAERINDLAPIDGPAKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHGVYPNEAHGVTTA
DALKSLERIFKADIAPDQVAAIILEPIQGEGGFNVAPADFMQALRDLCDTHGILLIADEV
QTGFARTGKLFAMQHYEVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIAEEQLCQRAEQLGSHLQEVLNQARATCPAIVDVRGRGSMVAVEFND
PQTGEPSPEFTRLVQQKAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFSKALDILARILK
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagctcagaactgaatcaacgtcgccagcaggcgacgccgcgcggcgtaggcgta
atgtgtaactactttgtcgagaaggcggaaaacgccacgctgtgggatatcgaaggcaat
gaggtgatcgatttcgccgccgggatcgccgtgttaaataccggtcaccgtcatccgaaa
gtggtcgccgcggtcgccgatcagctgcaggcgttcacccacaccgcctatcagattgtg
ccgtacgaaagttatgtttcgctggcggagcgtatcaacgatctggcgccaattgacggg
ccggcaaaaacggctttcttcaccaccggcgcggaagcggttgagaacgcagtgaaaatt
gcccgcgcttacaccggccgcccggggctgattactttcggcggcggcttccacggccgt
acctttatgaccatggccctcaccggtaaggtcgcgccctacaaaatcggcttcgggccc
ttcccgggatcggtctatcacggcgtttatcccaatgaggcgcacggcgtgaccaccgcg
gatgcgctgaaaagcctggagcgcattttcaaagcggatattgcgccggaccaggtagcg
gccatcatcctcgagccgatccagggggaaggcggctttaacgtcgcgccggccgatttt
atgcaggcgctgcgcgatctgtgcgatacccacggtattctgctgatcgctgatgaagtg
cagaccggtttcgcccgcaccggcaagctgttcgctatgcagcactatgaggtgaaaccg
gatctgatgacgatggcgaaaagcctcgccggcggtttcccgctgtcgggcgttgtcggt
cgcgccgaggtgatggatgcgccagccccaggcgggctgggcggaacctatgccggtaac
ccgctggcggtggccgcggcgcacgcggtgctggatgtcattgccgaagaacagctgtgc
cagcgcgctgagcagttgggtagccatctgcaggaagtgctcaaccaggcgcgcgctacc
tgcccggcgatcgtggatgtccgtggccgggggtcgatggtggcggtggagtttaacgat
ccgcaaacaggcgagccgtcgccggagttcacccgccttgtgcaacagaaagcgcaggaa
aacggcctgctgctgctgagctgtggcgtctacggcaacgtgatccgcttcctgtatccg
ttgactatccccgacgcccagttctcgaaagcgctggatattctggcgcgcatcctgaag
agctaa

DBGET integrated database retrieval system