KEGG   Klebsiella pneumoniae subsp. pneumoniae KP5-1: A593_11345Help
Entry
A593_11345        CDS       T03368                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
kpk  Klebsiella pneumoniae subsp. pneumoniae KP5-1
Pathway
kpk00620  Pyruvate metabolism
kpk00680  Methane metabolism
kpk01100  Metabolic pathways
kpk01120  Microbial metabolism in diverse environments
kpk01200  Carbon metabolism
Module
kpk_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:kpk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A593_11345
  Energy metabolism
   00680 Methane metabolism
    A593_11345
Enzymes [BR:kpk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A593_11345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIE01118
LinkDB All DBs
Position
complement(2333029..2335680)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGDTIKDALGENILDRVETIRKLSKSSRAGNEANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPNGEAASNPEVIARTLRKLKDQPNLNED
TIKKAVESLSLELVLTAHPTEITRRTLIHKMVEVNSCLKQLDNKDIADYEHHQLMRRLRQ
LIAQSWHTDEIRKYRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEANLGYQLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDVQVLISELSMVECTDELR
ALAGAEGAQEPYRYLMKKLRTQLMETQAWLEARLKGQKLPKPAGLITQNEQLWEPLYACY
KSLQACGMGIIANGELLDTLRRVKSFGVPLVRIDIRQESTRHTEALGEMTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRQWEPSEETREVLDTCKVIAEAPRGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFALPVAPLFETLDDLNNANDVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTSAILEANLLPPPEPKAEWRDIMAEL
SDVSCKMYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVEGGKQSELEAMCRDWPFFSTRLGMLEMVYSKADLWLAE
YYDQRLVKPELWALGTELRKLLAADINVVLAIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRQAEEAGKDPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcattgcgtagtaatgtcagtatgctcggcaaggtgctgggc
gataccatcaaggatgcattgggagaaaatattcttgatcgtgtcgaaactatccgtaag
ttgtccaaatcttcacgcgccggcaacgaagctaaccgccaggagctgctgaccacgctg
cagaatttgtctaacgacgaactgctgccggttgcccgtgccttcagccagtttctgaat
ctggcgaacaccgctgagcagtaccacagcatttcgccgaatggcgaagcggccagcaat
ccggaagtcattgcgcgtaccctgagaaagctcaaagaccaacccaatctcaacgaagac
accatcaaaaaagcggtggaatctctgtctctggagctggtattaaccgcccacccgacc
gagatcacccgccggacgctgatccataaaatggtggaagtgaacagctgcctcaagcaa
ctggacaataaagacatcgccgactacgaacaccatcagctgatgcgccgtctgcgccag
ctgatcgcccagtcctggcatactgacgagatccgtaaataccgcccgtctccggtcgac
gaagccaaatggggcttcgcggtggtggaaaatagcctgtgggaaggggtgcctaactat
ctgcgcgagctgaacgaacagctggaagccaaccttggctatcagctgccggtggacttc
gtcccggtgcgtttcacctcgtggatgggcggcgaccgcgacggcaacccgaacgtgacc
gctgacatcacccgccacgtgctgctgctcagccgctggaaagccaccgatctgttcctc
aaagacgtgcaggtgctgatctccgagctgtcgatggtggagtgtaccgacgaacttcgc
gcgctggctggcgccgagggtgctcaggaaccgtaccgttatctgatgaagaaactgcgc
actcagctgatggagacccaggcctggctggaagcgcgcctgaaaggtcagaagctgccg
aaaccggcaggactgatcactcagaacgagcagctgtgggagccgctgtacgcctgctat
aaatcgctgcaggcctgcggcatgggcattatcgccaacggcgaactgctcgacaccctg
cgccgcgtgaagtctttcggcgtaccgctggtgcgtattgatatccgtcaggaaagcact
cgccataccgaagcgctgggcgaaatgacccgttacctcgggatcggcgattacgaaagc
tggtcagaagccgacaaacaggctttcctgatccgcgaactgaactccaaacgtccgctg
ctgccgcgtcagtgggagccaagcgaagagacgcgcgaagtcctcgatacctgcaaagtg
atcgccgaggcgccgcgcggatcgatcgccgcctacgtgatctcgatggccaaaacgccg
tccgacgtgctggcggttcatctgctgctgaaagaggccgggattggttttgctctgccg
gtggccccgctgttcgaaacgctggacgacctgaacaacgccaacgatgtcatgactcag
ctgctgaatatcgactggtaccgcggctttatccagggcaagcagatggtcatgattggc
tattctgactccgccaaagatgctggcgtgatggccgcctcctgggcgcagtaccaggcg
caggacgcgctgatcaaaacctgtgagaaagccggtatcgaactgacgctgttccacgga
cgcggcggttccatcggccgcggcggcgcgccagcccacgcggcgctgctctcgcagccg
ccgggaagcctgaaaggcggcctgcgcgtcacagagcagggcgagatgatccgctttaag
tacggcctgccggaagtgaccatcagcagtctgtcgctatataccagcgccattctggaa
gccaacctgctgccgccgccggaaccgaaagccgaatggcgcgacatcatggctgagctg
tccgacgtctcctgcaagatgtatcgcggctacgtacgtgaaaacaaagatttcgtgcct
tacttccgctctgcgactccggagcaggagctgggcaaactgccactgggttcgcgtccg
gcaaaacgtcgcccgaccggcggcgtcgagtcgctgcgcgccattccgtggatcttcgcc
tggacccagaaccgcctgatgctaccggcctggctgggcgctggcgccgcgctgcagaag
gtggtcgaaggtggaaaacagagtgaactggaagcgatgtgtcgcgactggccgttcttc
tccacccgccttggcatgctggagatggtttactcgaaggccgacctgtggctggcggag
tactacgatcagcgcctggtgaagccggagctgtgggcgctgggtaccgagctgcgtaag
ctgctggctgccgacatcaacgtcgtgttggccatcgccaatgactcccatctgatggcc
gacctgccgtggatcgccgagtctatccagctgcgtaatatctataccgacccgctgaac
gtcctgcaggcggaactgctgcaccgttcacgccaggccgaagaagcaggcaaggacccg
gatccgcgcgttgaacaagcgctgatggtcaccatcgccggcgttgccgccggtatgcgt
aacaccggctaa

DBGET integrated database retrieval system