KEGG   Klebsiella variicola KP5-1: A593_16015Help
Entry
A593_16015        CDS       T03368                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
kpk  Klebsiella variicola KP5-1
Pathway
kpk00730  Thiamine metabolism
kpk00790  Folate biosynthesis
kpk01100  Metabolic pathways
kpk02020  Two-component system
Module
kpk_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kpk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    A593_16015
   00790 Folate biosynthesis
    A593_16015
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A593_16015
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpk04147]
    A593_16015
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kpk00537]
    A593_16015
Enzymes [BR:kpk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     A593_16015
Exosome [BR:kpk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A593_16015
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kpk00537]
 Enzymes
  A593_16015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest PT-VENN
Motif
Other DBs
NCBI-ProteinID: AIE01969
LinkDB All DBs
Position
3340624..3342054
Genome map
AA seq 476 aa AA seqDB search
MEMTKVKLSALFIALVPLLGSPVIHAETTAAPVLENRAAQGDITTPGGARRLTGDQTEAL
RASLINKPAKNVILLIGDGMGDSEITAARNYAQGAGGFFKGIDALPLTGQYTHYSLDKKT
GKPDYVTDSAASATAWTTGVKTYNGALGVDIHENAHQTILELAKAAGLATGNVSTAELQD
ATPAALVAHVTSRKCYGPTVTSEKCPSNALEKGGKGSITEQLLNARPDVTLGGGAKTFAE
TATAGEWQGKTLREQAEARGYQIVTDAASLAAATDASQAKPLLGLFADGNMPVRWEGPKA
SYHGNIDKAPVTCTPNPKRDASVPTLAQMTEKAIDLLSRNEKGFFLQVEGASIDKQDHAA
NPCGQIGETVDLDEAVQKALEFARKDGNTLVIVTADHAHASQIIPADSKAPGLTQALNTH
DGAVMVMSYGNSEEESMEHTGTQLRIAAYGPHAANVVGLTDQTDLFSTMKAALSLK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggagatgacaaaagtgaaattaagcgccctgtttattgccctggttcctctgcttggc
tcgccggttattcatgcagaaaccactgctgcgccggttctggaaaatcgtgctgcgcag
ggagatatcaccactcccggcggcgcgcgtcgtttaaccggcgatcaaaccgaagcgctg
cgcgcctcgttaatcaataagccagctaaaaacgttattttgctgattggcgatggcatg
ggtgattcggaaatcaccgctgcgcgaaattatgcgcaaggggcaggcggtttctttaaa
gggattgacgccttgccgttaaccgggcagtacacgcactattcgctggataaaaaaacc
gggaaaccggactacgtgaccgactcggcggcgtccgccaccgcctggaccaccggcgtc
aagacctataacggcgcgctgggcgtcgatattcatgagaacgcgcatcagaccatcctc
gagctggcgaaagcggcggggctggccaccggcaacgtttccaccgccgagctgcaggac
gccacccccgcagcgctggtggcgcatgtgacatcgcgtaaatgttacggccccacggtc
accagtgaaaaatgccccagcaatgcgctggagaaagggggcaaaggctccattaccgaa
cagctgctgaacgcccggccggatgtcaccttaggcggcggggcgaagacctttgccgaa
acggcgacggcgggcgagtggcagggcaaaaccctgcgcgagcaggcggaagcgcgcggc
taccagattgtgaccgacgcggcttcccttgccgccgcgactgacgccagtcaggctaag
ccgctgctgggactcttcgccgatggcaatatgccggttcgctgggaagggccgaaggcg
tcttatcacggcaatatcgataaggcgccggtgacctgtacgccaaacccgaaacgcgac
gcctcggtgccgacgctggcgcagatgacggagaaagcgattgacctgctgagccgcaac
gagaaaggtttcttcctgcaggtggaaggcgcttccatcgataaacaggatcatgcggcg
aatccgtgtggccagatcggcgaaaccgtagacctcgacgaagcggtgcagaaggcgctg
gagtttgcgcgaaaagacggcaataccctggtgatcgtcaccgccgaccatgcgcacgcc
agccagatcattccggcggacagcaaagccccgggactgacccaggctctgaatacccac
gatggcgcagtgatggtcatgagctacggcaactctgaggaagagtcgatggagcatacc
ggcacccagctgcgcattgcggcctacggtccacacgcggctaacgtcgtcggcctgacc
gaccagaccgacctgttctcgaccatgaaagccgccctgagtctgaaataa

DBGET integrated database retrieval system