KEGG   Klebsiella pneumoniae subsp. pneumoniae KP5-1: A593_16550Help
Entry
A593_16550        CDS       T03368                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
kpk  Klebsiella pneumoniae subsp. pneumoniae KP5-1
Pathway
kpk00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:kpk00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    A593_16550
Enzymes [BR:kpk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     A593_16550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4434 Glyco_hydro_14
Motif
Other DBs
NCBI-ProteinID: AIE02070
LinkDB All DBs
Position
3448571..3450628
Genome map
AA seq 685 aa AA seqDB search
MNKFAPLHPKVSTLLHGADYNPEQWENDPDIIDKDIAMMQQAKCNVMSVGIFSWAKLEPR
EGVFNFAWLDTILDKLYAAGIHVFLATPSGARPAWMSQRYPQVLRVGRDRVPALHGGRHN
HCMSSPVYREKTLKINTLLAERYSSHPAVLGWHISNEYGGECHCDLCQNRFRDWLKARYQ
TLENLNQAWWSTFWSHTYTDWSQIESPAPQGEVSIHGLNLDWHRFNTAQVTDFCRHEIAP
LKAANASLPVTTNFMEYFYDYDYWQLAKALDFISWDSYPMWHRDKDETALACYTAMYHDM
MRSLKGGKPFVLMESTPGATNWQPTSKLKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
VEKFHGAVVDHVGHIDTRIGREVSQLGEILSKLPEVRGCRTEAKVAIIFDQQNRWALDDA
QGPRNLGMEYEKTVNEHYRPFWEQGIAVDVIDADVDLTPYRLVIAPMLYMVRDGFAARAE
AFVASGGHLVTTYWTGIVNESDLCYLGGFPGPLRNLLGIWAEEIDCLNDGEFNLVQGLAG
NQCGLQGPYQVRHLCELIHTESAQTLATYRDDFYAGRPAVTVNGFGKGKAWHVASRNDLA
FQRDFFAALSRELDLPRAIAADLPPGVVATARTDGESTFVFLQNYSAQSHTLTLPPGYRD
CLTDAAAPDPLILSAWDCRILRRHA
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttgcacctttacatccgaaggttagtacgctgctgcatggcgcggattat
aatccggagcaatgggagaatgaccccgatattattgataaagacattgccatgatgcag
caggcaaaatgcaatgtgatgtcggtgggaatatttagctgggcgaaactggagccgcgc
gaaggggtatttaacttcgcctggctggatactatcctcgataaactgtatgccgccggc
attcatgtttttctggccacgccgagcggcgcgcgtccggcgtggatgtctcagcgctat
ccgcaggttctgcgggtgggacgcgatcgggtgccggccctgcacggcggccgtcacaac
cactgtatgtcgtcaccggtctatcgcgagaaaaccctgaaaatcaataccctgctggca
gagcgttattcttcacacccggcggtactgggctggcatatttccaatgaatatggcggt
gaatgccattgcgatctctgccagaaccgttttcgcgactggctgaaggcgcgttaccag
accctggagaacctcaaccaggcctggtggagcaccttctggagtcatacctataccgac
tggtcgcagattgaatcacctgcgccacagggagaggtgtcaatccacggtctcaatctt
gactggcatcgctttaacaccgctcaggtgaccgatttctgccgccatgaaattgccccg
ctgaaggcggctaacgcctccctgccggtgaccactaactttatggagtatttctacgat
tacgactactggcaactggcaaaggcactggactttatctcgtgggacagctatccgatg
tggcaccgcgataaagacgaaaccgcactggcctgctacaccgcgatgtatcacgacatg
atgcgcagcctgaagggcggcaaaccgtttgtgctgatggagtccacaccaggcgccacc
aactggcagccgaccagcaaactgaagaagccgggaatgcatattctctcctcgctgcag
gcggtggcgcatggcgccgactcggtgcagtatttccagtggcggaaaagccgcggttcg
gttgagaaatttcacggcgcggtggttgaccacgtcgggcacattgatacccgtattggt
cgtgaagtcagccagctcggcgagatactgagcaagctaccagaggtccggggttgtcgc
accgaggcgaaagtagcgattatcttcgaccaacaaaaccgctgggcgcttgatgacgcc
caggggccgcgcaatctgggtatggagtatgagaagacggtcaacgaacactaccgtccg
ttctgggaacagggcattgccgtcgatgtgattgacgctgatgtcgatttaacgccatac
cggttagtgattgccccgatgttatatatggtgcgcgacggctttgccgcgcgggcagag
gcgtttgtcgccagcggcggccacctggtgaccacctactggaccggcatcgtcaatgag
tccgatctctgctatctcggcggcttcccgggcccgctgcgcaatctgctggggatctgg
gcggaagagatcgactgtctgaatgacggcgagtttaatcttgtgcaggggcttgccggg
aatcagtgcggtctgcagggtccctatcaggtgcgccatctctgtgaactaatccatacc
gagagcgctcagacgctggccacctaccgggatgatttctatgccggacggccggcggtg
acggtgaacggtttcgggaaaggtaaagcctggcatgtcgcctcccgcaacgatttagcc
ttccagcgcgatttctttgctgccctgagcagggagctggatctgccacgagcgatagcg
gcggatttaccgcccggcgtagtggctaccgcgcgcaccgacggtgagagcacgtttgtc
ttcctgcagaactacagcgcgcaaagtcatactctgactctgccgccggggtatcgggat
tgcctgaccgacgcggcggcgccggacccgctgatcctctcagcatgggattgccgtatt
cttcgtcgtcacgcctaa

DBGET integrated database retrieval system