KEGG   Klebsiella variicola KP5-1: A593_18145Help
Entry
A593_18145        CDS       T03368                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
kpk  Klebsiella variicola KP5-1
Pathway
kpk00020  Citrate cycle (TCA cycle)
kpk00190  Oxidative phosphorylation
kpk00650  Butanoate metabolism
kpk01100  Metabolic pathways
kpk01110  Biosynthesis of secondary metabolites
kpk01120  Microbial metabolism in diverse environments
kpk01130  Biosynthesis of antibiotics
kpk01200  Carbon metabolism
Module
kpk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
kpk_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:kpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A593_18145 (sdhB)
   00650 Butanoate metabolism
    A593_18145 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A593_18145 (sdhB)
Enzymes [BR:kpk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A593_18145 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     A593_18145 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AIE02362
UniProt: A0A087FKI8
LinkDB All DBs
Position
3793011..3793727
Genome map
AA seq 238 aa AA seqDB search
MKLEFSIYRYNPDVDDAPHMQDYTLEAEEGRDMMLLDALIQLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETSERLEGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgagttttcaatttatcgctataacccggatgttgacgacgctccgcatatg
caggattacaccctcgaagcggaagaaggtcgtgacatgatgctgctggatgcgctgatc
cagctgaaagaaaaagatccgtcgctgtcgttccgccgctcctgccgtgaaggggtttgc
ggttccgatggcctgaacatgaacgggaaaaacggtctggcgtgcatcacgccaatctcc
gcgctgaatcagccgggcaagaagattgttatccgtccgctgccaggattaccggttatc
cgtgatttggtggtggacatggggcaattctatgcacaatatgagaagattaagccttac
ttgttgaataatgggcaaaatcctccggctcgcgagcatctgcagatgcctgagcagcgt
gagaaactcgatggtctgtacgagtgtattctgtgcgcatgttgttcaacctcgtgcccg
tcgttctggtggaacccggacaagttcatcggcccggctggcctgctggccgcgtatcgc
ttcctgatcgacagtcgcgataccgaaaccagcgagcgcctggaaggcctgagcgatgct
ttcagcgtattccgctgtcacagcattatgaactgcgtcagtgtgtgtcctaaagggctt
aacccgacgcgcgccatcggccatattaagtcgatgctgctgcagcgcagcgcgtaa

DBGET integrated database retrieval system